SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005857 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005857
Domain Number 1 Region: 386-560
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-47
Family SPRY domain 0.0000613
Further Details:      
 
Domain Number 2 Region: 154-220
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.39e-16
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 8-64
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000012
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000005857
Domain Number - Region: 104-141
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0298
Family AN1-like Zinc finger 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005857   Gene: ENSORLG00000004655   Transcript: ENSORLT00000005858
Sequence length 569
Comment pep:novel chromosome:MEDAKA1:6:9491033:9498529:1 gene:ENSORLG00000004655 transcript:ENSORLT00000005858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVLDTPAKCPLCDELTRDPVVLKCNHRFCQRCIGDLWSVTPTGPYHCPEWRCKTVYQT
LPFDSSLIRPPTPGRPVQARGSAGKRKASSQIPEQPVSKRSNENKTSTPVPCHYCPKTGC
QPAVNTCLVCGASMCKEHLLPHLESPVFQSHTLISPVEDISLWKCQEHQEVNRIYCRQCE
MCVCTVCTLIGSHRDHACISIREAENQLRANLKEEIKQLQETEQQVKNRVSQLGEKKETS
RVVLTKAQESVKQQYGAIREALDQEEQSALQCILKEEKRVLGGLEDKLSSLQKTLQCIQK
SLHTLEGLADAKADKRVQDQVFIMLFETPEEVDCARLNCLKTWTEKRLDTVIINMPGKDR
DLYRLQCKTSAAFECITTPKYGIIPVLDEDTAHPKLQLSDNNRKVSYSETQQAYAEHESR
FTSFPQVLASNILEKGRWYWEVNVPVDDGRWKVGLCESQMERKGQKDNSRLGFNSCSWCL
ACDKKKLEALHNKESIPVKTDGLQTLGVFLDFEDGSLSFFNASPGGSLVLLHYFKHSFSS
PLYPAFSVSSNNSGKNKAPLNVELKNHLE
Download sequence
Identical sequences H2LIM7
ENSORLP00000005857 ENSORLP00000005857 8090.ENSORLP00000005857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]