SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005864 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005864
Domain Number 1 Region: 198-364
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-41
Family Dual specificity phosphatase-like 0.0000114
Further Details:      
 
Domain Number 2 Region: 374-508
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.25e-29
Family PLC-like (P variant) 0.0038
Further Details:      
 
Domain Number 3 Region: 58-190
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000259
Family Voltage-gated potassium channels 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005864   Gene: ENSORLG00000004658   Transcript: ENSORLT00000005865
Sequence length 511
Comment pep:known chromosome:MEDAKA1:14:11495633:11502756:-1 gene:ENSORLG00000004658 transcript:ENSORLT00000005865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMSVHFQPGSDAGVNGNVAKMEDAKVEIDNGKEESALPDTLYHNIQRAITPFVMSFGFRL
FGVVLIIVDFVLVIVDFSLASKSREVAKALEAVSLSISFFFLADVLLRVYVEGFKVYFRS
KLNIVDACVVVLTLVVTMVYTFSDLSGVSLIPRVVNFFRFLRIIILVRVFRLAAQKKELE
KVTRRMISENKRRYQKDGFDLDLTYVTDRVIAMSFPSSGKQAFYRNPIKEVARFLDTKHE
GHYKVFNLCSEKGYDPQHFHYRVERVFIDDHNVPALEDMLKFTASVREWMSADPQNVIAI
HCKGGKGRTGTMVCTWLIDSDQFESAQDSLEYFGERRTDKTRSSKFQGVETPSQSRYVGY
YEVMKNKFNRQLPPPQSLRIKSLRIHSIAGVGRGDGSDLKVKIIVRGELVFQCVCAQQEN
CTVFPDAGSNAAVISLQNGPVVEGDVKVMFESSAGLPKGYEDVPFYFWFNTSFVEHNKLF
FPREELDNPHKPKTWNLYKEDFGITVYFLPV
Download sequence
Identical sequences H2LIN4
ENSORLP00000005864 ENSORLP00000005864 8090.ENSORLP00000005864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]