SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006058 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006058
Domain Number 1 Region: 145-451
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-98
Family Protein kinases, catalytic subunit 0.0000000000981
Further Details:      
 
Domain Number 2 Region: 13-126
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-17
Family Pleckstrin-homology domain (PH domain) 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006058   Gene: ENSORLG00000004813   Transcript: ENSORLT00000006059
Sequence length 480
Comment pep:novel chromosome:MEDAKA1:15:16086933:16104141:-1 gene:ENSORLG00000004813 transcript:ENSORLT00000006059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDELTCLCQIGLVFTGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDSPDERDEWTEAIQMVADKLQRQEEERIQCS
PTSNIDNMVEEEMDISTTHHKRKQTMSDFDYLKLLGKGTFGKVILVREKASGKYYAMKIL
KKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSR
ERVFSEDRTRFYGAEIVSALNYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITD
AATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELIL
MEEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVDWQDVYDKKLV
PPFKPQVTSETDTRYFDEEFTAQTITITPPEKFDEDGMDCLDNERRPHFPQFSYSASGRE
Download sequence
Identical sequences H2LJ72
8090.ENSORLP00000006058 ENSORLP00000006058 ENSORLP00000006058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]