SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006460 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006460
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily POZ domain 5.1e-29
Family BTB/POZ domain 0.00000351
Further Details:      
 
Domain Number 2 Region: 520-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 464-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000115
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 4 Region: 561-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000526
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 427-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000439
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 6 Region: 370-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000217
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006460   Gene: ENSORLG00000005122   Transcript: ENSORLT00000006461
Sequence length 638
Comment pep:novel chromosome:MEDAKA1:13:10756859:10773008:-1 gene:ENSORLG00000005122 transcript:ENSORLT00000006461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKMGVLQLNNPTHSSTLLQRANQMRLTGTLCDVIITVDGQEFPAHRTVLACTSKMFEILF
HRSSLRYALDFLSPKTFQQILEYAYTASLQATAEDLDDLLYAAEILEIEYLEEQCLKVLE
TIQAEESEEVSMRNHGSGDHSRTRHWRHMLMSKKHSIQDGTNCTTPTALHHLALYHVTER
SSPGPEPEAGLDSKLKQDSEANMESSQHCGTTVPQDSSADPDRSIKSEIMEVDDLNSSEG
RGSSGKEGSCVSDQPRGEGPGTPLRGSVITSARELHTSPEDGGQVVGSALDCFPGITDKH
LASIYSVASNHTGESLPVSVSVTSSLAVPLDPRAYSGLLHQGLLHRELLSRLGQFAAGMR
HESQTQGQQCCGECGLQLHSRQAAEQHRRLHNEEKGSACEFCGKHFQDSMRLRMHMLSHT
APAEALVCDQCGATFSSEEALEAHRLTHTGTDMAVFCLLCAKRFQTQKALQQHMEVHAGM
HSYICSHCDRPFPSHTTLKRHLRSHTGDHPFECEFCGSCFRDDGTLRGHKRIHTGEKPYE
CNGCGKRFSLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTVC
QDFCPSLAAMQKHMKGHKPEEVPADWRIEKTYLYVCYV
Download sequence
Identical sequences H2LKA9
ENSORLP00000006460 8090.ENSORLP00000006460 ENSORLP00000006460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]