SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006865 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006865
Domain Number 1 Region: 114-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000111
Family Hairy Orange domain 0.0019
Further Details:      
 
Domain Number 2 Region: 50-107
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000127
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006865   Gene: ENSORLG00000005453   Transcript: ENSORLT00000006866
Sequence length 305
Comment pep:known chromosome:MEDAKA1:7:10167409:10168704:1 gene:ENSORLG00000005453 transcript:ENSORLT00000006866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPADSMEKQTASPIAGAPANGSHTPDKPKNASEHRKVSTIYLCFLFSPSQSSKPIMEKRR
RARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRVQMSAALSADASV
LSKYRAGFNECMNEVTRFLSTSEGVNTEVRSRLLSHLSSCMSQMMSMNYPQQTPSQPAHL
AQPLHVQLPSSLPIGGAAMASKLSPAEAVSPKVFGGFQLVPAPDGQFAFLIPNPAFGSAT
APVIPLYTNAGVPVAVNASPVHGSSAPTATSPVHGMTSFSGGSQAVSPVGVSTGSESSEP
VWRPW
Download sequence
Identical sequences H2LLF4
8090.ENSORLP00000006865 ENSORLP00000006865 ENSORLP00000006865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]