SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007412 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007412
Domain Number 1 Region: 432-601
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-50
Family SPRY domain 0.0005
Further Details:      
 
Domain Number 2 Region: 6-73
Classification Level Classification E-value
Superfamily RING/U-box 1.7e-19
Family RING finger domain, C3HC4 0.05
Further Details:      
 
Domain Number 3 Region: 127-193
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.78e-17
Family B-box zinc-binding domain 0.0006
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000007412
Domain Number - Region: 316-332
Classification Level Classification E-value
Superfamily RING/U-box 0.0589
Family RING finger domain, C3HC4 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007412   Gene: ENSORLG00000005894   Transcript: ENSORLT00000007413
Sequence length 609
Comment pep:novel chromosome:MEDAKA1:17:8244228:8251702:1 gene:ENSORLG00000005894 transcript:ENSORLT00000007413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQLDLERFKCSICLDLLKDPVTIPCGHSYCMKCIQGFWDEEEKIPSCPQCRKTFIPRPVL
EKNIVLADLLEMQKINLCYAAPEDVVCDVCTGRKLKAIKSCLICQASYCEKHLQPHLDAA
AFKKHKLVEPSKNLQENICSRHDEVMKMFCRTDQKCICYLCSVDEHRGHDTVSAAAERTE
RQRELEESQQQIQQRIQDREKEVKLLQQEVEAINHSADQTVKDSEKIFTEVIRLIQKRSC
DVKQQIRSQQQTEGSSFKVLYDVRINTSARYQTLLRSLLIISQSTEIQFLNGFWESLSNK
EPKASQKTFTAALNKRHSYCMKCIQGFWDEEEELEQEITELKRRDAELKQLSLTEDHSQF
LLNYPSLPPLSESTHSSSINVRPLRYFEDVTAAVSELRDKLQDILREEWTNISLTVTHVD
VLLPEPEPKSRADFLKYSLQITLDPNTAHRRLLLSEENRKMTMMKKTQSDSDHPDRFTDY
GEALSKESLTGRCYWEVEWKGYLVYIAVAYKNISRSGDESGFGFNDKSWALYCSQDNLFF
FHNSIQTSISAPGSSRVGVYLDHRAGVLSFYSVSESMTLLHRVQTTFTQPLHAGFLFDHV
GETAEFCKL
Download sequence
Identical sequences H2LMY9
ENSORLP00000007412 8090.ENSORLP00000007412 ENSORLP00000007412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]