SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007426 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007426
Domain Number 1 Region: 373-542
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-43
Family SPRY domain 0.0011
Further Details:      
 
Domain Number 2 Region: 9-79
Classification Level Classification E-value
Superfamily RING/U-box 2.83e-18
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 139-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.51e-16
Family B-box zinc-binding domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007426   Gene: ENSORLG00000005908   Transcript: ENSORLT00000007427
Sequence length 561
Comment pep:novel chromosome:MEDAKA1:17:8276726:8279504:-1 gene:ENSORLG00000005908 transcript:ENSORLT00000007427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKRVNLNEAAFSCSICLDLLDIPVTIPCGHSYCMVCIKGFWKGKENDSRSCPQCRETFTS
APALVKNTMLAALTEELQKTGICPPAAEHHYAGAEDVACDICTGKKLHAVKSCLTCLASY
CEEHLQPHSDVAAFKKHKLVEPFKNLQETICSIHNEVMKLFCRTDQKSICYLCSVEEHKS
HDTVSAAAERTERQRELEESQQQIQQRIQDREKEVKLLQQQEEATNMSVDQVVENSEKIF
TDIICLIDKKKGEVKNKFRSQQQTKVGQVKGLQEELEQEITELKRRDAELKQLSLTEDHH
QFLHSYSSLPPLSGESTHSSSIIVRPPGNLKDVTAAVLELRKKLEDILREELTRISLTIT
QVDVSPWEPKSRPDFLTYYRNLTLDPNTAHTRLMMLKKKKVIGVARTLPYPDNAGRFTFW
WQVLSKESLTGRCYWEVEWKGDGLYVAVAYNSISRDGKGKECSFGWNENSWAVHIYGKTC
IFYHNCEKVSISAPVSSRIGMYLDHTAGVLSFYSVSKGMTLLHRVQTTFTKPLHAGIFFS
FLTMTSKADITITILMKNKKK
Download sequence
Identical sequences H2LN03
ENSORLP00000007426 ENSORLP00000007426 8090.ENSORLP00000007426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]