SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007436 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007436
Domain Number 1 Region: 210-392
Classification Level Classification E-value
Superfamily Serpins 1.7e-39
Family Serpins 0.00028
Further Details:      
 
Domain Number 2 Region: 113-141,172-217
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000805
Family I set domains 0.049
Further Details:      
 
Domain Number 3 Region: 22-97
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000118
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007436   Gene: ENSORLG00000005916   Transcript: ENSORLT00000007437
Sequence length 392
Comment pep:novel chromosome:MEDAKA1:1:17580620:17583938:1 gene:ENSORLG00000005916 transcript:ENSORLT00000007437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRQAVLFLLLPLIFELSQCTQIQTIHGSTLVLPCMHPESDSNGMEVSWKFQGEVIRPVL
KHGSASFAKQGQLVISPVTFSSAGEYECFTNGTDVEIMGKYSVRVMGYFEFFVKVTEGSS
VHIPCYHPTSDQSKPNALWFKEEESGKRTKLNTEDESNEKKKVELLYPGDPDQTIILREA
AMEDAGLYTCESHNGGKHTTAYLSVEVRPTAPPLKCEGFDEECQDENSRIAEALLRESLT
EFSMNVFSHLRELQPSNNLLFSPISISVLLSNLLLGAGDDTRRALQSAIFVPHDFNCIHS
QMKKLREKMSQSLQMASQIYYNPQMNLSESFTNRSIQHYEAKPVQLLETPEENAFMINSW
VANKTKNKITHLVDSVPPSTQVIILSAVSFEG
Download sequence
Identical sequences H2LN13
ENSORLP00000007436 8090.ENSORLP00000007436 ENSORLP00000007436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]