SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007790 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007790
Domain Number 1 Region: 370-533
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-47
Family SPRY domain 0.00077
Further Details:      
 
Domain Number 2 Region: 24-95
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-20
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 155-215
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.05e-16
Family B-box zinc-binding domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007790   Gene: ENSORLG00000006195   Transcript: ENSORLT00000007791
Sequence length 535
Comment pep:novel chromosome:MEDAKA1:17:8630282:8631989:-1 gene:ENSORLG00000006195 transcript:ENSORLT00000007791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAKPATAPLRNLRGKMAQQGVDLDRERFCCSICQGLLKDPVTIPCGHSYCMKCIQGFWDE
EEKIPSCPQCKKTFTPRPVLVKNTMLADIMEELKKTGLQAAPADLCYAGPEDVVCDVCTG
RKLKAIKSCLICLASYCEKHLQSHLDVAAFKKHKLVEPSKNLQENICSRHDEVMKMFCRT
DQKCICYLCSVEEHKGHDTVSAAAERTERQRELEEVEAINHSADQTVKDSEKIFTQMIRL
IQKRSCDVKQQIRSQQQTEVSRVKDLQEELEQEITELKRRDAELKQLSLTEDHNQFLLNY
PSLPPLSESTHSSSINVHPMKYFEDVTAAVSELRDKLQDILREEWTNISLTVTHVDVLLP
EPEPEPKSRADFLKYSCQITLDPNTANSRLLLSEENRKVTMMNKPQSDSDHLDRFTDYIQ
VLSRESLTGRCYWEVEKKGDFVYIAVTYKNISRSENESLFGFNDKSWALVCSPDRFLFLH
NRTKSSISAPGSSRVGVYLDHRAGVLSFYSVSESMTLLHRVQTTFTQTLHAGLLI
Download sequence
Identical sequences H2LP10
8090.ENSORLP00000007790 ENSORLP00000007790 ENSORLP00000007790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]