SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007841 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007841
Domain Number 1 Region: 538-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000353
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 2 Region: 709-766
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000814
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 595-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000151
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 652-709
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000106
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 498-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000104
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 405-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000112
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007841   Gene: ENSORLG00000006241   Transcript: ENSORLT00000007842
Sequence length 785
Comment pep:known chromosome:MEDAKA1:10:14271943:14274976:1 gene:ENSORLG00000006241 transcript:ENSORLT00000007842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HIDGEHIVVSVPEGMLLSDVMTDEGILLEHELEVEGLETHVVEGLEAEVVEGLETEVAEV
VEGLEVDVESLHSQGVEAHEITAEDMVATGHSVIMPDNILGTEVAIEEALEAHHHHVLTS
DLIQDPNHHHDDMPDQVFVAELLSDHQDSTLDHQLVSEGLMVTEANSETIIHQQLPNEGV
PLQTDEDDDGRSSSEDYLMISLDEVGEKLDIGDTPLEISTEVMDKEIKEEEESEVIKVYI
FKAEADDDLGGTEVITEDDYQNGHPDLEAASSGRLGVGRDKMVYMAIKNPPKDEEEEDET
SVCEKIYYDFLVRIDGKKQTKKLANTKTQPGLLSFKVFDVFDLNVFVGTTIDQVKNGVAA
PYLQIREGLGANRALKSKVRRKRKGDTRQCQTAVIIGPDGMPLTVYPCHICGKKFRSRGF
LKCHMKNHPDHLLKKKYQCTDCDFTTNKKISFHNHLESHKLLSHNSERSPEYTEYTRRYH
ESSPLGSDKLIVKDPEPKLHHCKYCDYETAEQGLLNRHLLAVHSKNFAHVCVECAKGFRH
PSELKKHMRTHTGEKPYHCPHCEFRCADQSNLKTHIKSKHGADLPFKCSHCPQAYADARE
LQRHMETVQGHKTHQCPHCEHKSTNSSDLKRHIISVHTKDFPHQCDVCEKGFHRPSELKK
HAETHKGNKVHQCRHCNFNAPDTFTLSRHILSMHTKDLPFKCKRCRRGFRQPAELKKHMK
THSGRKVYQCQYCEYNSTDASGFKRHVISIHTKDYPHRCDYCTKGFRRPSEKSQHIARHH
KDMLM
Download sequence
Identical sequences H2LP61
ENSORLP00000007841 8090.ENSORLP00000007841 ENSORLP00000007841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]