SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007868 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007868
Domain Number 1 Region: 202-322
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-34
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007868   Gene: ENSORLG00000006263   Transcript: ENSORLT00000007869
Sequence length 334
Comment pep:novel chromosome:MEDAKA1:9:11690746:11695673:1 gene:ENSORLG00000006263 transcript:ENSORLT00000007869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDQSKDFEERRMIRAALRDLRKKNREAMLGCTQEELEDQRLKERETRLQELLQQRDRAQR
AHAGPGAGEVVVKKVEKSADGSTISQVTKTNRFTQSDDRNKSSTTVETSYVQKIDRTLHS
KSFSYTSSSTSNTSKKVGSVFDREDDTPSRALERRQAERRKEVARAQTMPKTSAMQARKA
MMEKLEKEGGGPFNQVVAKVNRVQRSTSFGVPNANSIKQMLLDWCRAKTRSYEHVDIQNF
SSSWSDGMAFCALVHSFFPDAFDYSCLSPSNRRHNFEVAFSAAETCVNCMPLLEVEDMMI
MGNKPDSKCVFTYVQSLVNHLRRYEMSMGRSSDL
Download sequence
Identical sequences H2LP88
ENSORLP00000007868 8090.ENSORLP00000007868 ENSORLP00000007868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]