SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007904 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007904
Domain Number 1 Region: 580-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000024
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 2 Region: 1051-1100
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000228
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 512-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000139
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 616-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000148
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 661-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000454
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 6 Region: 1005-1059
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000236
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000007904
Domain Number - Region: 481-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000713
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number - Region: 258-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00645
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007904   Gene: ENSORLG00000006291   Transcript: ENSORLT00000007905
Sequence length 1320
Comment pep:novel chromosome:MEDAKA1:7:11000434:11020754:-1 gene:ENSORLG00000006291 transcript:ENSORLT00000007905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEENEVESSSDAGPSGMEEPSESGMGMESSEAMSADSSDAAAPHAQAPESDCHVGQSSEG
LVVFIPETSSSTDVRVSSVHLPDSSSIAPSTSVSTVTQSVLVSESAQVLVHSSAVSEGAM
VVSDSTASTSSDLGSAIDKIIESTIGPDIMNGCIAVTSAEDGGAETTQYLILQGPDDGAP
MVAQMSSSSFSNRVAIDALPEGPTSTCLDQQEEPQGSHDEAGQSRDMKTPPAAEGSGNQP
PNLAELEDLMEVVIVQQFKCKMCPYKSTSKDTLINHMKDKHFKPAVVTITAVSFAGESPK
KRKRGRPPKTEMKDKPQKAEEEEDDIVDAGAIDDPAEDSDYSPADDDGKGRPPAVLRKPS
TPRRPRRKVGRPRKYYVSDEAHSGKEAESTDTMAGVDPSTPEEASSSGLGNNTEMLSLGD
KAVAAISQSDSENKDPSSNSQPEEEFFPKKRGRPSKRFLRKKYKKYINRNRYYKSFKPLL
RPHNCWICGSRFLTQDDLRFHVNSHEGNDPESFKCLKCNYRCKRWSSLKEHMFNHEGTKP
FKCEECDYSSVYRKDVIRHSAVHNKDKKRKTELAPKVSEFPCPVCGRVYPMQKRLTQHMK
THSSEKPHMCDKCGKSFKKRYTFKMHLLTHIQSLGENKFKCEFCDYTCSNKKLLLNHQLS
HTNDRPFKCDYCKYSTSKEEFLVSHLAIKHTGEKPFSCDMCHFMTKHRKNLRLHVQCRHP
EAFDEWSLAHPEEPAMRRRRPFFSLQQIEDLKQKNDEAQDLQNTIVTVDSATLQAMQGMD
KASVSQDALGNTTIIYEQIKAESSDLSAQNALDLLLNMSNARELVGNGLQVAVLKSDGKT
LENGALSSVTAAPGQTQKIVTFHVSENGETVLQEAYEAATSETGELTHIAIEACEAAEDF
CVEEQAATEIHNASYSDTWIHLYKVAINSNLVNCRLSSNGENSSQILEVSESESLKGDKY
YLTSALADGILQQVELSSEAPASPSAVGSPSLGTKRFSCRICMETFHGRSDMENHKRAHL
DPNTFKCTDCEFTSTSWSEVKAHLGQHSYLRPHKCSSCSFASKNKKDLRRHMMTHTNEKP
FACKFCSQRFNRNGHLKFHMERLHNQDHPTRKSRTATSQQTIIVQSDEEALATLQCEDLQ
SHQRGITPEELQALGHDHIVVAQEQTMSDQEEGTYIQQITTIDGQTAVQQLMTGENQVQY
IISQDGVQLIIPQEYVVVADGNHIQMADGQIIQYEPEQQIAVSHDGQIQYLPVNCEQQMV
NPEDLEAAAHSADKLIFTPAAAADAAMVQTQTVYTEATPEQLEQLQQQGVQYDVVTFSNE
Download sequence
Identical sequences H2LPC3
ENSORLP00000007904 8090.ENSORLP00000007904 ENSORLP00000007904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]