SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007924 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007924
Domain Number 1 Region: 364-531
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-45
Family SPRY domain 0.00078
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 5.08e-21
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 140-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.07e-16
Family B-box zinc-binding domain 0.00057
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000007924
Domain Number - Region: 97-352
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 0.0696
Family RNA-polymerase beta-prime 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007924   Gene: ENSORLG00000006308   Transcript: ENSORLT00000007925
Sequence length 540
Comment pep:novel chromosome:MEDAKA1:17:9045824:9075738:1 gene:ENSORLG00000006308 transcript:ENSORLT00000007925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKGVDLDQETLRCSICLDLLKDPVTIPCGHSYCMKCIQGFWDEEDKTPSCPQCRKTFI
PRPVLVKSTLLANIIEKLRKTGLQAAPADLCYAGPEDVVCDVCTGRKLKAIKSCLICLAS
YCEKHLKPHLDAAAFKKHKLVEPSKNLQENICSHHDEVMKMFCRTDQKCICYLCSVEEHR
GHDTVSAAAERTERQRELEESQQQIQQRIQDREKEVKLLQQEVEAINHFADQTVKDSEKI
FTQMIRLIQKRSCDVKQQIRSQQQTEVSRVKDLQEELEQEITELKRRDAELKQLSLTEDH
SQFLLNYPSLPPLSESTHSSSINVRPLRYFEDVTAAVSELRDKLQDILREEWTNISLTVT
HVDVLLYSRQITLDPNTAHRRLLLSEENRKVTVMEKPQSDSDHPDRFTDCFQVLSRESLT
GRCYWEVEWRGEYVDVAVAYKNISRSGDESGYGYNDISCFSFYHNNIKTSISTPVSSRVG
VYLDHRAGVLSFYSVSKSMTLLHRVQTTFTQTLHAGLSTHLDLIGQNSSPLLIGNSEQLP
Download sequence
Identical sequences H2LPE2
ENSORLP00000007924 8090.ENSORLP00000007924 ENSORLP00000007924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]