SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007927 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007927
Domain Number 1 Region: 292-466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-50
Family SPRY domain 0.00048
Further Details:      
 
Domain Number 2 Region: 8-76
Classification Level Classification E-value
Superfamily RING/U-box 2.65e-19
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 136-181
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000488
Family B-box zinc-binding domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007927   Gene: ENSORLG00000006311   Transcript: ENSORLT00000007928
Sequence length 469
Comment pep:novel chromosome:MEDAKA1:17:9100254:9101691:1 gene:ENSORLG00000006311 transcript:ENSORLT00000007928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKGVDLDQETFSCSICLDLLKDPVTIPCGHSYCMKCIQEEERIPSCPQCRKTFIPRPV
LKKNTMLANIIEKLRKTGLQAAPADLCYAGPVDVVCDVCTGRKLKAVKSCLICLASYCEK
HLQPHLDAAAFKKHKLVEPSKNLQENICSRHDEVMKMFCRTDQKCICYLCSVDEHRGHQT
EVSRVKDLQEELEQEITELKRRDAELKQLSLTEDHSQFLLNYPSLPPLSESTHSSSINVR
PLRYFEDVTAAVSELRDKLQDILREEWTNISLTVTHVDVLLPEPEPEPKSRADFFKYSCH
ITLDPNTAHRQLLLSEENRKVTFMEKPQSDSDHPDRFTDRFQVLSRESLTGRCYWEVERR
GFFVCVGVAYKNISRSGNESAFGCDDKSWSLFTSPDRFSFNHNRTKTSISAPVSFRVGVY
LDHRAGVLSFYSVSESMTLLHRVQTTFTQPLHAGLGMGYGATAEFCKLK
Download sequence
Identical sequences H2LPE5
ENSORLP00000007927 8090.ENSORLP00000007927 ENSORLP00000007927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]