SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008181 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008181
Domain Number 1 Region: 357-520
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.65e-48
Family SPRY domain 0.00056
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 6.85e-22
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 140-204
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000534
Family B-box zinc-binding domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008181   Gene: ENSORLG00000006517   Transcript: ENSORLT00000008182
Sequence length 537
Comment pep:novel chromosome:MEDAKA1:17:10012592:10014770:-1 gene:ENSORLG00000006517 transcript:ENSORLT00000008182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHKGVDLDQETFSCSICLDLLKDPVTIPCGHSYCMKCIQGIWDKEAKIPSCPQCRKTFI
PRPVLVKNTMLANIIEKLKKTGLQAAPADLCYAGPEDVVCDVCTGRKRKAIKSCLICPAS
YCEKHLQPHLDAAPLKRHKLVEPSKNLQENICSRHDEVMKMFCRTDQKCICYLCSVDEHR
EESQQQIQQRIQDREKEVKLLQQEVEAINHSADKTVKDSEKIFIMMIRLIQKRSCDVKQQ
IRSQQKNEVSRVKDLQEELEQEITELKRRDAELKQLLLTEDHSQFLLNYPSLPALSESTH
SSSINVRPLRYFEDVTAAVSELRDKLQDILREEWTNISLTVTHVDVLLPEPEPKSRADFI
KYSRQITLDPNTANGLLLLSEENRKVTVLEKPQSDSDHLERFTYYLQILSRESLTGRCYW
EVEWRDFVDVAVAYKNISRSGNESGFGYNDKSWSLVCYPDRLSFNHNNIKTSISAPVSSR
VGVYLDHRAGVLSFYSVSESMTLLHRVQTTFTQTLHAGLRSSLIESYIAILQQRSSQ
Download sequence
Identical sequences H2LQ44
8090.ENSORLP00000008181 ENSORLP00000008181 ENSORLP00000008181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]