SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008194 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008194
Domain Number 1 Region: 437-604
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-47
Family SPRY domain 0.00077
Further Details:      
 
Domain Number 2 Region: 8-74
Classification Level Classification E-value
Superfamily RING/U-box 2.21e-18
Family RING finger domain, C3HC4 0.054
Further Details:      
 
Domain Number 3 Region: 134-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.39e-17
Family B-box zinc-binding domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008194   Gene: ENSORLG00000006531   Transcript: ENSORLT00000008195
Sequence length 615
Comment pep:novel chromosome:MEDAKA1:17:10066686:10081045:-1 gene:ENSORLG00000006531 transcript:ENSORLT00000008195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKGVDLDQETFCCSICLDLLKDPVTIPCGHSYCMKCIQGFWDKGPQCRKTFIPRPVLV
KNTMLAALVDQLKKTGLQAAPADLCYAGPEDVVCDVCTGRKLKAIKSCLICLASYCEKHL
QSHLDAAAFKKHKLVEPSKNLQENICSRHDEVMKMFCRTDQKCICYLCSVEEHRGHNTVS
AAAERTERQRELEESQQQIQQRIQDREKEVKLLQQEVEAINHSADQTVKDSEKIFTEMIR
LIQKRSCDVKQQIRSQQQTEVSRVKDLQEELEQEITELKRRDAELKQLSLTEDHSQFLLN
YPSLPPLSKPKIEKNFDVVVPVIWMSQTEVVHTNDLKWKGPKLKKKNNIHNHKNRLERIL
WKTFREKQNKKVPVQVPAGGPETESPTTLYYGAPKGAIDEKKISIRWAPVSFMCAPVSIS
IFYHILKDFEPEPKSRADFLKYSCQIRLDPNTANGHMLLSDENRKVKALIKPQSYSDHPD
RFTDRFQVLSRESLTGRCYWEVERRGTGVSVAVTYKNISRSGYESEFGCNDKSWVLICSP
KCFSFYHSSIKTSISAPVSSRVGVYLDHRAGVLSFYSVSESMTLLHRVQTTFTQPLHAGM
RLYGDFGDTAEFCKL
Download sequence
Identical sequences H2LQ56
ENSORLP00000008194 ENSORLP00000008194 8090.ENSORLP00000008194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]