SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008284 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008284
Domain Number 1 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.02e-16
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 577-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000284
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 694-747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000165
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 619-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000854
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 387-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000829
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 449-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000578
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008284   Gene: ENSORLG00000006601   Transcript: ENSORLT00000008285
Sequence length 754
Comment pep:novel chromosome:MEDAKA1:14:14241307:14249741:1 gene:ENSORLG00000006601 transcript:ENSORLT00000008285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDVTRLAIHSEEPKIILHGSDEGGAGGQEFVVELQETVLVSEGEGEGMALHRFAPDELVI
QDAVEDVVSEYVHCDEDEDVAVETCVMALEGEEEGVAMGDIPEDGLDPDQQEDDQDGCGD
YLMISCKFALQIRMPKVSKTFDCDATAEDIAVKYILCSKCTMQGEIQESGSKTHNNYQPY
VKCILCPSTVDEAGKMVSEDGTEVTVEGAVEDQEVEKDEDGQEVIKVYIFKADSGEDDMG
ESVDISDGDAESMALTESSSQTLREKLIYKSGDSHHNQGHHGKISTRVVPMDYGIVHRDG
AFSVEERSQKEARISITSPSLYWIIAGVEDSDGCENRNGAASALLHIDESDGIDEINRQR
TRSRRRSEPRQVQTAIIIGPYGQPLTVYPCMLCGKKFKSRGFLKRHTKNNHQDVLSRKKY
QCTDCDFTTNKKASLHNHMEVHALSSKAPFECEMCGKEFHQQGALFSHRLQHHHREPKSK
MHKCKFCNYETAEQGLLNRHLLAVHSKSFPHICVECGKGFRHPSELKKHMRTHTGEKPYS
CLYCDYKSADSSNLKTHIKTKHSKEMPYKCERCFQTFAEEEELLQHGLTHEENKTHQCAH
CDHKSSNSSDLKRHIISVHTKDYPHKCAVCGKGFHRPSELKKHSLSHRTKKLHQCRHCNF
KIADPFVLSRHILSVHTKEQQASAEKSKGQKERRIYQCQYCDYSTGDASGFKRHVISIHT
KDYPHRCEICSKGFRRPSEKNQHIMRHHKDVVQA
Download sequence
Identical sequences H2LQE4
ENSORLP00000008284 ENSORLP00000008284 8090.ENSORLP00000008284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]