SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008404 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008404
Domain Number 1 Region: 18-174
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.93e-27
Family Calponin-homology domain, CH-domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008404   Gene: ENSORLG00000006695   Transcript: ENSORLT00000008405
Sequence length 234
Comment pep:novel chromosome:MEDAKA1:9:12110167:12110868:-1 gene:ENSORLG00000006695 transcript:ENSORLT00000008405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQSNIQSAASKSIRPFKSSEEYLYAMKEDLAEWLNTLYDLDVTADTFMDGLETGCALC
RHANNVNRAAHDFQQKHPEATQTMKVPSKDVVFQSRNVVPGSFLARDNISNFITWCRQEL
WIKDVLMFETNDLVERSNEKNFILCLLEVARRGSKFGMLAPMLIQLEEEIEEEIRDQESL
EVDGGESTEQSSPSRCYSWKESCPSVQDQEEPEPEPFIWPQKRILCDMRNLDEL
Download sequence
Identical sequences H2LQQ9
8090.ENSORLP00000008404 ENSORLP00000008404 ENSORLP00000008404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]