SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008987 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008987
Domain Number 1 Region: 359-499
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-40
Family SPRY domain 0.0007
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 8.17e-21
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Domain Number 3 Region: 140-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.65e-17
Family B-box zinc-binding domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008987   Gene: ENSORLG00000007165   Transcript: ENSORLT00000008988
Sequence length 499
Comment pep:novel chromosome:MEDAKA1:17:11616787:11618340:1 gene:ENSORLG00000007165 transcript:ENSORLT00000008988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKGVDLDQETFCCSICLDLLKDPVTIPCGHSYCMKCIQGFWDEEKKIHSCPQCRKTFI
PSPVLVKNFMFAALVDQLKKTGLQASPADLCNAGPEDVVCDVCTGRKLKAIKSCLICLAS
YCEKHLQPHLDAAAFKKHKLVEPSKNLQENICSRHDEVMKMFCRTDQKCICYLCSVDEHR
GHDTVSAAAERTERQRELEESQQQIQQRIQDREKEVKLLQQEVEAINHSADQTVKDSEKI
FTEMIRLLQKRSCDVKQQIRSQQQTEVSRVKDLQEELEQEITELKRRDAELKQLSLTEDH
SQFLLNYPSLPPLSESTHSSNINVRPLRYFEDVTAAVSELRDKLQDILREEWTNISLTVT
HKYSCEITLDPNTAYRELLLSEENRKVTRMEKSQSYSDHPDRFTDRFQVLSRESLTGRCY
WEVEWRGTEVDVAVAYKNIRRSGNESSFVRNDKSWTLFCSRNIFLFYRNSTKTSISAPGS
SRVGVYLNHRAGVLSFYSV
Download sequence
Identical sequences H2LSC6
ENSORLP00000008987 8090.ENSORLP00000008987 ENSORLP00000008987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]