SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009885 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009885
Domain Number 1 Region: 1229-1281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000218
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 32-83
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000305
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 862-913
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000185
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 632-655,735-762
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000925
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 5 Region: 1094-1118,1175-1202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000126
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 6 Region: 96-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000412
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 181-202,237-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000007
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 2-40
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000716
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 832-873
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000243
Family Classic zinc finger, C2H2 0.047
Further Details:      
 
Domain Number 10 Region: 449-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000867
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number 11 Region: 603-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000095
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 12 Region: 1206-1237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000464
Family Classic zinc finger, C2H2 0.052
Further Details:      
 
Domain Number 13 Region: 765-806
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000595
Family Classic zinc finger, C2H2 0.051
Further Details:      
 
Domain Number 14 Region: 1046-1081
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000255
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 15 Region: 268-291,344-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000427
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000009885
Domain Number - Region: 919-940
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0257
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009885   Gene: ENSORLG00000007885   Transcript: ENSORLT00000009886
Sequence length 1286
Comment pep:novel chromosome:MEDAKA1:19:8319934:8325975:-1 gene:ENSORLG00000007885 transcript:ENSORLT00000009886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDERKYKCDECGRCYRHAGSLTNHRRTHEVGPFRCPVCGKENANASALKSHLRGHTAFKK
YSCGECGKGFRVATQLATHERVHLAQKVKEESREERPFRCDMCGKSYIHQRSLNNHKKSH
QLGKFECSVCFKLFNNMAALYSHQRSHKAKSGSDFSLTDRSHTGTELDQFSPQSQRAPEN
FCHLCQVRLSTEEAFQEHIQMHNSSSLSFSIEDAPSENHNVSYDVGVSLADTSTADSDER
PFKCHVCGKCYRHSGSLINHKRSHQVGVFQCSVCKKNYPHLAALKSHLRLHKTQSTSFSF
QTEQVGGAKPVLEEPGMAHRALYQEQFDQDSSPDIMTHLPQNENVTQRHMCTDCGGTFTD
IAQIKSHSCPFLLHQPETANAEYISGFNFLVGNGHRAVGNPEDSVEFHNLNGRHSQSFFK
ETFHENMSGTQLSNGVGNNNPVEEDDSDLYQCSICGNNYSSMRALRCHLRGHTQSSDTPA
SSGPSPMSSREDVKEENEGEMMICSTCGESFANRVDLINHQILHNKDQEEVLDQSQSEAS
ESKEDQPIICGTCGISCTSYNHLDNHGCTAERGDELVECKQEADNVFKQEETSPRREPDD
AEDRQYKCEQCGRSYRHAGSLLNHKKSHKTGLFRCQICQKRFYNLLALKNHQRSHFDIKR
NSFPSLRPQVHLSRVRESLQNSEAAVDPPEEAQTEPSQNAGTRQSDPGPHHPAQEPEGKR
AETEAESSVTSKDASDQRPFACDQCGRTYRHAGSLVNHKNSHKTGEYYCSICNNTYSNQL
AMKNHLRTHFLYKRHTCQNCGKGFRVDQLSSHTCNGHPDSGESQPESNPIKEERPFRCNI
CGRSYRHAGSLLNHKNTHKTGHFSCTFCSKPFTNPMALRNHTRIHTQKKKFVCLTCGKAF
RLASILHNHQRIHNRVLSHFSCPSCGRSFQSRSSLRRHHCRRGQGRSVLPGVQRSDRGSK
CFTSSISVEFGEKHKEQINKVKKQLPISDCCASMNLNLLSQDGTIVDLKTKIVCKVNKYV
TSSLLLDKYSAFGMKKKLMPSRSCGRCDLCGRSYRHAGSLLNHKKSHSENLHHCALCLQT
FPDSLTLQIHSQMRRHCCPECGKTFCLITHLQSHMEVHSKEQAELSGRQQLPAAPEHSPH
GPELISSSPESLGAGDTQKQGPPTFSQPPRDISDSQEKSHVCEHCGRTYRHAGSLLNHKN
SHKTGAFFCSVCHKEFTNLMALKNHRRIHTEPKRYQCLECGKAFRVSTQLICHRRIHTKE
KPFTCQLCSKNFSSKSNLRHHQKMHQ
Download sequence
Identical sequences H2LUV7
8090.ENSORLP00000009885 ENSORLP00000009885 ENSORLP00000009885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]