SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009966 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009966
Domain Number 1 Region: 3096-3162
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000143
Family RING finger domain, C3HC4 0.005
Further Details:      
 
Domain Number 2 Region: 1543-1672,1710-1745
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000343
Family Extended AAA-ATPase domain 0.081
Further Details:      
 
Domain Number 3 Region: 1888-2133
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000148
Family Extended AAA-ATPase domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009966   Gene: ENSORLG00000007947   Transcript: ENSORLT00000009967
Sequence length 4312
Comment pep:novel chromosome:MEDAKA1:8:10649043:10671073:1 gene:ENSORLG00000007947 transcript:ENSORLT00000009967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAVKLLEKTCKGVKLGSSLQDFPDVPLACMNLVASVSDFLQCNKLEAQENDPAVQDFAKG
SITQAMNSMRTWMSQSFKQSFHRRVWSYLFQEKKAEFEESADDQIKFYCENIEELGASNP
HVASIVEKCALEAVTSLCQTKSEGKVFKFFTITGKFWKLISTIIEKSWPRDSQGHYQDDE
EVVLRHLLSWTAAKDIFHLHGKEEKLFEKLSDDAKEKIVQAISAFTAMNQQLVQGHIKIS
LLRIILQRRDAFLELQKIGTDCLSEGGQYSYTAKMKKLLDHRRTEVEAVYHEKQLVDVIL
DMSHKLEEHVPVDVDDLKEKAQINIEIMPLNDFMKVYHFDEPETEMTGIVSYFELDDEIR
EMGEELHTFQESYLFKMLWEKYARNFAADDREGDDPDEDEMEDKTATLDVIYDDIFKYCI
DEYKIIHTRLKNSSITLEEVNQLFGAYKGKHNDLSQELRIMSRVDKAGDTRWIDSRVEQI
VQYHELHLAVASAQIIMKVKETLGLQGDFRVLETLTNILHADFQREPLSRIDNELMQAKM
VLVDITEPRLVCLKELHIRGHFVKWVKDALEDINELKVFVDLASISAGENDMDVDRVACF
HDAILGYSSLLYELKPDSNFHAFKEVLKKLWKAFENDKNLPKKLCDSARHLEWLKTVKDS
HGSVELSSLSLASAINQKGIYLINGQRTKKLSLDTALKLQIPEEHEDGRQMRYYSLEDLR
ELQNKLMLMSGKGDQGQNEVDRFAEVFASVQRLAEAFIALYTAGNPLFRNWEVHINCCVR
GHEPSIIMDFNLHRAGSVIVEGSVEEQLPDLCRKMEKCLEYWMNFVDKQRFHYYYLNYYT
AEQIVYLCRQLSQQNMSNVENQVLMMLSFIKPNCTSLDLRQIWHDLQYEILTKSQEQNEV
MDEMNELHLKEAKGLQVFDQIWNAYMKNMKEFLPNIIDIKSLGRLLEILANKEDFQESDS
EEDISVDVPKSFTNRLLPKGLAAGNPNLIICPHNEVLTACISTYMSSADEELPTYDEVLL
CNPSTPYEQVELFLRRCLSPGYRGQKIYSLLYGDLLTYDVSSKVEIFFQRMKMQSRKDYS
LVIICSSEREHAYLPSAFSQYKLHMVPQEPLQNIQMYLQKHYAVPSDQSSAAAVFTDRLC
VGVISSKRAGVGKSLYIKRLFEKLKHSAKKSSALKCIRLTEPEVNETIILQDLLNIPARK
ELTMFHFDVTSSVQKGLHEFLFKLLILRYLMDAEGKMWRCNDKQLYVIEILEPILNTAAT
INSSFTDVFPNIFCRPPKEVLMLEMRKQEDPNMVNPNDPLMDDKEFRSEAFQRPYQYLTR
FHNHVDLDVFTYQGLEGSHVECLQMLLMFCGIMDPSWAELRNFAWFLNLQLRDCETSVFC
DAAFTGDTLRGFKTFVVDFMILMAKDFATPSLSISDQSPGRVQANLDGVRDEDLAPFLIR
KRWETEPHPYIFFNDDHNSMTFIGFHLQPNGQNSVDAIDPTSKRVIKRNVMTRELYEGLK
LQRVPFNIDFDSLPRWEKIERICNVLGIQWPLDPDETYELTTDNILKMLAIHMRFRCGIP
VIIMGETGCGKTRLIKFLCELQKGGVSTENMKLVKVHGGTTSEMIYAKVIEAENIASINQ
QDYGFNSVLFFDEANTTEAISSIKEVLCDKTAKGETLISNSGLQIIAACNPYRKHTDEMI
RRLESAGLGYRVRAEETDEKLGSIPLRQLVYRVQALPPSMCPLVWDFGQLNDHTERIYIQ
QIVQRVIKGKDINQKYFEYITDVLSASQKYMRTRNDECSFVSLRDVERCMQAFVWFYDNH
GMFFSEFQQYEMIQNGEGNLEQFEERDPILWSLVLATGVCYQACLENKDKYRQKISEKLP
HPYTPAKILKEISIMQDLLLNGVPMGDTIARNNALKENVFMMVLCIELRIPLFLVGKPGS
SKSLSKTLVADAMQGQAAHSELYKTLKQVHLVSFQCSPHSTPEGIINTFKQCGRFQEGKN
LKEYISVVVLDEIGLAEDSPKMPLKTLHPLLEEGCIDDEPLPHKKVGFIGISNWALDPAK
MNRGIFVSRGDPDEKELIESAKGICSSDVMVLEKVRDFFKPFAIAYLNICDKQGKGFFGL
RDYYSLIKMIFAVAKASQRKPTAEEIVKAVLRNFSGKDDVDAVSVFTSRLNIAPDLETIN
TIEFVRENIQAVTQEDECRYLLVLTKNYAALQILQQIFFSERDQPEIIFGSSFPKDQEYT
QICRNINRVKICMETGQTVVLLNLQNLYESLYDALNQYYVCLGGQKYVDLGLGTHRVKCR
VHKDFRLIVIEEREVVYKQFPIPLINRLEKHYMDIHTVLKPEQKRMVNELDKWVNLFATV
TSQHGAATYRYQPPDVFIGYHSGTCASVILQVMEEQKDILEVSDSERKLLEEAKLIILKC
ATPDSVVRLDCAALPKGECEFLSKVYFEEQNNSCLVDYILAHTRQEGRCCSFFTEVTTFS
RLLTAFDLEPLAQMLNGVELLSLQQFDTEHSFLKKIRSFLKAENGDSSVGTQNKILIIQC
DFNEAAQGANLLASAKYSSINEINKITQENKRSKVFVYFITRLPRIEGGTSYIGFHGGPW
RSVHIDDLRRSKDIVSDIKTLQTMTISQMFETETMLPGAMDVDDVSTETEPMEIEGSNDV
VDTTALLRSCVQSAVGMLRDQAESGFRSTQRVAILLTLLSDGDEIKSEFLKTVKRRLHSV
LVTHDGNALSNFNSNWVLKEASNIDALQEGGTFRQTLWKRVQAVVVPLLAQLISVIDRDL
NMDLLLDVDCCESVKRLWLDIFSDDKLLELSQLPMDRRPETTTILVQNHIAQDSNMGCSM
PFSWKIRDYLEELWVHALQHEGKGQTQQDFIKFFWRTPLGRYLAAADPNTQLEFYHRYLQ
DFLSLTMNITRLEDLQLLCSALNCGVNELRLQVNDTETVTSLPWVHAAYHQFKNRLQNLL
RMTCIEPKVTEDLLGNQPARNTEELMLDVYAAFACLERLEPNDLNTDAQMQAWLRQVKKV
QVPIELICAEESVKKYGQRSKVFVSRVQSRWNRIFSLSLFVEHMLLGNEELEEKLKPLVL
EQTGKLGKMLEENSDLKTQQAFEAVIRLLKTCKEEVVERLFRFGHSICPVCMGDPQDPLP
LPCEHIYCLGCIKQWLSPGQMFCPLCLEPVSDDFPLFPSDEIRVCVAQHAQFRKQCNAFF
IDLVSTACFKDNSPPCSAVIFHLLSFLMVEANPITYLRANHQIHTKMLSPFDDSVDKNPV
VRSVVLKLLLKYSFDDVKEYLQLHLLEVEQSNLLEESDKTELYCLYINCLEDSMFDRSSA
DKQVILQEESAFLTDFLQSHSQSGKEATVEYLQQLARVRMDLDTTASLIMENLQNKGFQR
ETQRATEAYLDSMMKLCVQSGNDWYRVYLIRKISSQRGVEFVQKIQKKDQMRWLFPDEVL
LKSEETIQIDQYLVYGEDYRTIREAVAKVMMEGKVEGLEEVCKGINCLPQQKTVHYLLAL
YREITTLYRNTNPNLHPKPEQLDALINCFHSSEVLSSQEEKAFAQALVTNNLGPLTVCPR
ASGAQRVMVDVTIHLAVVLLCGKNGFLAPLQQLAVTPANMQASFLPTMPEDMVALARQAL
NSMQLQWYTCPNGHPCTIGECGQPMQRSRCVDCGAVIGGENHAPVDGFQHLQFQGDRTQP
GHILGDPRNRDNPNMMDTKGLSSVPFTTLRMFTHMAMLLGFCHHAPFISAIIKPPVADPA
AFLFEHLEKDLKHLIRSLGKGTDDTICAVHLLISSLLEPHQQQKWPVPYDSRLSSKDARN
AWDVEMSNTVITPQLKNLERRLKEVNSVIRSDSRISANPVMTLVFGDPKHFLASLHPNSL
LHCSAVWSCRQKVSLLSLTHIVEQNDGKDTLPVLWRFLHREAEIRLVKHLPDILTLQKDL
VKKFQNTSELAFDTIGEFLETQKAGSLKAWYMKRITIFLKTWNQLRVSLATNGEIKIPAD
FCQKDLDLNSDFKVLLPRRQGPGLCSTALVSYLISVHNDLIYCVDKHTEEETSFKVSPAD
LTELHVIHYELERDVMPLVLSNTQYSIQKGQETIHEYDLLKIQQQIISRFLLGKPLLTLN
GIPTLVNRHERNYEIIFKDIKTKVKQESLQNLTLVSIAGELQSYSEVCEALSTLEVALGF
LAMTGGEPHMQLSHYLEEVLQMGNQVAQHILKTLSMCCLKHCVALWQLLASLKSENMLRL
KRDPFVGISEDYKQVLGEDEHRQLTAFFSICNGDTFLLEMHEFMVLVLKMPNATETYRPD
WGLKDTLVSYMERKDLDIPQDVEELFPDGMCLCHYVEAWKFIVTFKQERAQK
Download sequence
Identical sequences H2LV38
ENSORLP00000009966 ENSORLP00000009966 8090.ENSORLP00000009966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]