SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010286 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010286
Domain Number 1 Region: 692-743
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000486
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 36-108
Classification Level Classification E-value
Superfamily E set domains 0.00000016
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.025
Further Details:      
 
Domain Number 3 Region: 2-38
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000301
Family Somatomedin B domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000010286
Domain Number - Region: 489-580
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00314
Family Integrin alpha N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010286   Gene: ENSORLG00000008190   Transcript: ENSORLT00000010287
Sequence length 794
Comment pep:known chromosome:MEDAKA1:12:13241252:13248517:-1 gene:ENSORLG00000008190 transcript:ENSORLT00000010287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETCEGKCGQQLDSCSCHPTCGSLKTCCPDYKEFCIDVAPQSGSILGGTDFFVLEANFTQS
SQIVCRFNSEIDTEGYVDDSGRAHCISPLLYQTGWVPLHISSDNGTTFSRSGAWLSVHTG
KLSSEFKALLVNSTKWQYYGTPGVGGYLQMTWNTTLVNADKVNIELWGYREMGEPYSENW
QGEMEYLYSLAKDQPNNGSFSFLPKIAENGFSSWELGSVRVSSSTYPDGMRNVQAAWTED
HALAWHLEQKFRDNSTAWAWEKCLAWDQLEIQLPNFLNEIIDCPCTLAQARADTGRFHTD
YGCDIEKGSVCTYHPGSVHCVRAIQASPQYAAGQQCCYDKTGAQVLTADSIGGSTPDRAH
DWGSPPFRKPPRIPGLSHWVYDVLSFYYCCLWSDNCHYYFKHRPSSDCRRYQSPNSAVVF
GDPHFITFDGVSYSFNGKGEYTLVTSADKQLTIQGRTEPIDGNAIKATKMSAVAMREAYS
DIIEVRLASGDNRLEVLHNQKSLSFAEQTWMDLQGVFVFSPTSSNVTVMFPSGAGVEVRQ
RGKTLTTTVLLPEEFGDSTQGLLGNINGDAKDDLALSNGQLVQNQSNAEELFAFGASWAV
PNASALFTYDSNYLLETYYFVPRHDPSFIPAFSAPEDPDDPLSDQAAEICSGESSPFCRY
DILVGRSLSMGNDTRRSFQSHISLVDDLKPVISCGWLPPPNNGKKLGTTYLQGARVQFSC
NEGYTLKGSAERICQKNAQWSGEEARNISGKLPGILAGSIVGASALILIMTMIVLHFRKQ
KRYGLFTSVYGKQQ
Download sequence
Identical sequences H2LVZ9
8090.ENSORLP00000010286 ENSORLP00000010286 ENSORLP00000010286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]