SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010362 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010362
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily POZ domain 1.9e-30
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 434-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-20
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 3 Region: 395-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-17
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 4 Region: 531-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.18e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 475-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.89e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010362   Gene: ENSORLG00000008258   Transcript: ENSORLT00000010363
Sequence length 778
Comment pep:novel chromosome:MEDAKA1:5:15870255:15875051:-1 gene:ENSORLG00000008258 transcript:ENSORLT00000010363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLSSHSSYLLQQLQEQRIQGLLCDCMLVVKGVCFKAHKNVLAAFSSYFRSLFQNSPSQ
KNDVFNLVIQDVSGIGQILDYMYTSHLDINQENVQALLDIAQNLQVPNVQNLCNAFLKPC
PPPVEMHSFTLPGMLGSEHDCLLGSSLTHDVNLHCPTEPPRPNLYSDTEHTRRMPVSLPN
SSSNCDMSSSSQSAEKPLHHGYKLRNFYSKQYFKLSAIQTNNAASNQVPGPLMMAEEQAC
QLGITPRASDTSVTSGNPLSSQPPSASAGKDVRSLMPSDNLNTPNTDLADSLSNKPVRPK
KAVYLKKYNYLRSQKALEEMCNKSVNEPVISSPIEHHQGESVVQTETSEAPVEISSARRE
EVSESAEVQLSNLPGSQDEPNLKSLPEPPQQPGHKQYCCGVCGKIFKHPSNLELHKRSHT
GEKPFQCSICGKNFSQAGNLQTHLRRHSGEKPYICELCGKSFTAAGDVNRHKVVHTGEKP
HLCDICGRGFNNLGNLKEHKRTHTMDKIYTCDQCGKSFNTQRKLLKHRVRHTGEKTHCCV
TCGKCFVGSGDLQRHIRSHTGEKPYICSTCGKSFTRSAMLRRHRNMHCKGPSVDNLATVS
PERPQNTDGATSVSKPDRHNRAAVVTQEPHFSIMMPNQALEKPSSPSSSPPLAAPHIQTP
RSSAHLSPASNPLPELRSLVPHHLLSSNPQERSSALPGTDRIKLVKHHGPQEALYVPYVE
NGSMSLDKDAPGKPYLPPADTSSNSSRQYRSGEGQFISSVTLWGLAMKTLQNDNEMEQ
Download sequence
Identical sequences H2LW75
ENSORLP00000010362 XP_004069016.1.28442 XP_011473391.1.28442 ENSORLP00000010362 8090.ENSORLP00000010362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]