SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010550 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010550
Domain Number 1 Region: 292-370
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.27e-22
Family Intermediate filament protein, coiled coil region 0.00012
Further Details:      
 
Domain Number 2 Region: 63-97
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000209
Family Intermediate filament protein, coiled coil region 0.0018
Further Details:      
 
Domain Number 3 Region: 71-178
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000246
Family Myosin rod fragments 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010550   Gene: ENSORLG00000008401   Transcript: ENSORLT00000010551
Sequence length 594
Comment pep:novel chromosome:MEDAKA1:9:13224502:13228073:-1 gene:ENSORLG00000008401 transcript:ENSORLT00000010551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSGLVSMSFMVDHHNMGPSSYRKARPASVSSSGFHSQRRRLTYSQPSSIDSLETFNGDMT
RRSEKEILQALNDRFAGYIDKVRNLEMHNRNLEAEAAALRQSQAGRTSVGEHYERELGDL
RGLLQQLTGEKARAVMEHDHLEEDIQHLRGRLEDEARNRDELEAAARAMKKYAEDCRLAR
MELDKKLCALEEEADFLKKNHEEEVADLLAQIQGAQVSFDMRDALKADVTSALREIRAQL
DSHASKSATHPEDWYQVRMERLSDAAKSNQDAIRGSQEEIAEYRRQLQSRIIELETLRGT
KESLERQRMESEDRHQDDINSLQETINQLDSELKNTKWEMASQLRDYQELLNVKMALDIE
IAAYRKLLEGEENRVVSGGSPYSYLDSRLSGHMKVKGEEISDTVIVEEQTDETQVTEVTE
EAGEESKSPESKSPRSKSPEAKSPEAKSPEAKSPEAKSPEAKSPPAKTPEPKSPEKETKP
AAAKEPPKEEKTAKEAPKKEEASKPSTPSKPSEDKPAPKSEPKEKAPAPKEEKPSAPKAD
TGESEAKGAPKPDPEKTESKTEVKKPEKPVPKSGTESKTSKEEQAKNSKGEEEM
Download sequence
Identical sequences H2LWQ8
ENSORLP00000010550 8090.ENSORLP00000010550 ENSORLP00000010550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]