SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011017 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011017
Domain Number 1 Region: 361-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 300-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.32e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 549-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.66e-16
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 262-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000934
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 487-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000149
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 
Domain Number 6 Region: 434-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000359
Family Classic zinc finger, C2H2 0.002
Further Details:      
 
Domain Number 7 Region: 466-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000652
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011017   Gene: ENSORLG00000008771   Transcript: ENSORLT00000011018
Sequence length 758
Comment pep:known chromosome:MEDAKA1:3:20410268:20415910:-1 gene:ENSORLG00000008771 transcript:ENSORLT00000011018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGQATALASDGKVLSEGGEALIQTGQGDEAGTMEMMVMDALDPALLQMKTEVLEGGGT
VTVTGGDEGQIITLQVVNMEEQAGAALGLGQLQLVQVPVTTTTVEGLQATYVEASAANKD
AVICHTLPLPEGFQVVKVGANGEVETVEQDELQAAQEDLQGQEGEEVEEDEEAAEIVTSV
PQDDPEWTKDPDYQPITAVRKGKKGKKSRLRYAEGDRDMDVSVYDFEEEQQEGLLSEVNA
EKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCGRA
FRTVTLLRNHLNTHTGTRPHKCTDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYSSVE
VSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTM
KMHILQKHTENVAKYHCPHCDTVIARKSDLGVHLRKQHSFIETGKKCRYCDAVFHERYAL
IQHQKTHKNEKRFKCDQCDYCCRQERHMIMHKRTHTGEKPFACEQCEKTFRQKQLLDMHF
KRYHDPTFVPTAFVCTKCSKTFTRRNTMLRHAEGCTGEASGDENGTPTPKKGRRGRKRKM
QAREKKPDKVDSDTEGELDEIEEEDDLLTEIEVEQAAPVIPIPAPIEPPVKRKRGRPPKN
KPEVCPCFSGISNLSVAAIIHVEDEVQEVEELVKKEVGAEQVNCTDETTEQVITGGGKPG
AQSEELSQADAAAQEVQLSAAPSNGDLTPEMILSMMDR
Download sequence
Identical sequences H2LY05
8090.ENSORLP00000011017 ENSORLP00000011017 ENSORLP00000011017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]