SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011482 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011482
Domain Number 1 Region: 7-121
Classification Level Classification E-value
Superfamily POZ domain 2.55e-25
Family BTB/POZ domain 0.0022
Further Details:      
 
Domain Number 2 Region: 508-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-18
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 3 Region: 545-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000225
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 615-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000868
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 305-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000499
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 411-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000007
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 464-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000125
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 652-696
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000113
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000011482
Domain Number - Region: 367-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0461
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011482   Gene: ENSORLG00000009152   Transcript: ENSORLT00000011483
Sequence length 845
Comment pep:novel chromosome:MEDAKA1:17:15086066:15094756:1 gene:ENSORLG00000009152 transcript:ENSORLT00000011483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLPPQDRHLAMPHHSHSLLKFLNEDRTRQKFCDVSVVVGGKVYSAHKVVLAHGSSYFHAE
LSKSSAATAQVTLDHVEDSVFQLLLGFLYTAECVVAEADLPALTEAARFLNMMDVLRLVC
EERGTNSVGVIHTQAEMMEISGKAVISSDSTGTDTNVQCPPEEKNAFFNQQFHTDTSLES
SLAPCAIVAPAEDAQKAEEKGVTTRRSARRRRAPTKYKRDNIKSSITTSEEKEKSATPRR
EDEERVEEDLVLESSTLLLVGNESSEQTRGSDEIHEDGEDDMQREMNSGNVAQGLDPVII
QTSNKKTLKCPKCDKTFDRAEGKYESHTRVHTGEKPFQCDICLQCYSTKSNLNVHKKKHT
SDASFPKKEHKCPFCNKLHASKKTLAKHVRRFHPDCTQEFLNKRKRKSASWECSVCSKTF
SRKPHLQEHMILHTQDRPFKCSFCDEYFKSRFARLKHQEKFHLGPFPCEICGRQFNDSGN
KKRHIECTHGGTRKWTCFICGKSVRERTTLREHLRIHTGEKPHFCSICGQSFRHSSSYRL
HLRVHRDDKRYECNECGKTFIRHDHLTKHQKIHSGEKTHQCEECGKCFRRHDHLTVHYKS
VHLGEKVWQKYKTAVHQCEVCKKEFKGKSSLEMHFRTHSGEKPHRCPECHQTFRIKKTLT
KHMVIHSDARPFNCPHCSATFKRKDKLKYHVDHVHIARFTEQPVGMDKPASAPFQEPSKG
YESEPKASLQSTPSNVCIPVTLVPVSVAGAAQGDAHAHRASALSSSSYSVVSIPAQAQQQ
NSGYQATTDLAFLEKYTLTPQPANIVHPVRPEQILDPREQSYLGTLLGLDSASLVQNISS
SDHAH
Download sequence
Identical sequences H2LZB0
ENSORLP00000011482 ENSORLP00000011482 8090.ENSORLP00000011482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]