SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011781 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011781
Domain Number 1 Region: 86-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 596-653
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000415
Family Homeodomain 0.006
Further Details:      
 
Domain Number 3 Region: 876-943
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000668
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 286-349
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000111
Family Homeodomain 0.01
Further Details:      
 
Domain Number 5 Region: 742-798
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000134
Family Homeodomain 0.0039
Further Details:      
 
Domain Number 6 Region: 53-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000149
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000011781
Domain Number - Region: 953-994
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0011
Family Tetracyclin repressor-like, N-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011781   Gene: ENSORLG00000009397   Transcript: ENSORLT00000011782
Sequence length 1072
Comment pep:novel chromosome:MEDAKA1:7:15073165:15078386:-1 gene:ENSORLG00000009397 transcript:ENSORLT00000011782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKRKSTMPCMIPSKIIHPIEDVERDSPVLLHQPRVSGGDTNECSKSDLGDDKDGAGNY
TCKLCNFETHDLNLFLDHVYSVHPEFRAEPSFVCMNCAVSAPKFEGLALHNARVHPSTLA
TTLQLRKRERRVVVEQTLSLTELGKDSEISITKTPIMRMLKGKSEPKRIVVSHPLSEEPL
SDPQSVCASREGGAREPAAVTVTHVPTIVHNGATKATLPSAIQIVNGSTALPLLKTPITQ
VVSVAQNRGVHHSAAVTAPLNVSSASSSSSSKNLPKVMIPLSSIPTYSASMDESSFLKTS
FSKFPYPTKAELCYLTVVTKFPEEQIKIWFTAQRLKQGISWSPEEIEEARRKMFNTIIQT
TPASTQSQSHPSPAQHTITVLPASLGAAGIPQFLQGSLVSQGGVIVTQPVVANGIQVSSA
PVALAVTPKPQAAARPMMQGRPAAALVAEKGVSMVVGTVGSSSAGSNIIVSSKSGGGDSN
SAVGGVINLSLGSSNHSKAKAGSDSSDKSKGDSASRVAAKVTDVSAASGSDGQKRKDVNG
SSSTTSSSPEDNSSARDSPNIKIDEALSPSSKSSSASPAPISSSRTSINAFLDPSFYKGK
KSQEQLTALKDSFQANQFPDQDEVDRLIGITGLTVREVRKWFSDRRYHFRNLKGGRCSTG
GQGKPSTGSGSGPPTPGGGSAGTPMDLSECNSNSGAKTPQQNSPDAFQNSAATATPTSPT
TPSRRTTRPPSSDFTAIRYKEREPHQVKALEASFAENADPPGEEVDRLRSETKMTRREIH
GWFTDKRKRMAAERKKEEAERLLKEGEDDMEVDEDGKPRDDGSGEPKVNPIKINLKMLKV
TEASGKLEGEGSENLTNSKPPQSSSQTAKASHSPKPTTVRGKKTVEQLHLLKQVYARTQW
PSATQYDDLISGTGLPRSEVVRWFGDCRYVQKNGPLKWLEEYQNMALEEEMQAENTQILQ
AHLDAQGRLEESQLQELVEKTGLTADLVRHWFSTQGSLLQNKPTAAQTTGAVAAGVAGTT
GSSPPEQQPAGGMDQKMEQSVSGFTTDAEKTNAEDILNASKGNNVHASSMFF
Download sequence
Identical sequences H2M058
ENSORLP00000011781 ENSORLP00000011781 8090.ENSORLP00000011781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]