SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011783 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011783
Domain Number 1 Region: 320-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-22
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 2 Region: 236-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 195-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000296
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 4 Region: 165-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000705
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 5 Region: 282-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000406
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000011783
Domain Number - Region: 138-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0172
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011783   Gene: ENSORLG00000009398   Transcript: ENSORLT00000011784
Sequence length 399
Comment pep:novel chromosome:MEDAKA1:20:16231877:16237752:1 gene:ENSORLG00000009398 transcript:ENSORLT00000011784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YYQEEECAGGGASSGVVTLCKVEGNGDDSKTADGHTSFNRDQIIVEVNLNNQTLNVSKGS
EGKSNPAAEGMFRHRRASKPDSEADEENEGGSEVGEEDEEDLKKGDIARQSCEEEDEEEE
EDEEEEEAEGPGQKVRLEEKQHFPCKKCPRIFNNRWYLEKHMNVTHNRMQICNNCGKRFL
LESELLLHQQTDCEKSIQCVTCGKAFKKLWSLHEHNKIVHGYAEKKFSCEICEKKFYTMA
HVRKHMVAHTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPFKCENCSERFQYKYQLRS
HMSIHIGHKQFMCQWCGKDFNMKQYFDEHMKTHTGEKPYICEICGKSFTSRPNMKRHRRT
HTGEKPYPCEVCGQRFRFSNMLKAHREKCFHVSSPMVTD
Download sequence
Identical sequences H2M060
ENSORLP00000011783 ENSORLP00000011783 8090.ENSORLP00000011783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]