SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012556 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012556
Domain Number 1 Region: 6-127
Classification Level Classification E-value
Superfamily POZ domain 1.49e-23
Family BTB/POZ domain 0.0017
Further Details:      
 
Domain Number 2 Region: 389-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.64e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 486-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-18
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.38e-18
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 352-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.78e-16
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000183
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 7 Region: 261-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000293
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012556   Gene: ENSORLG00000010006   Transcript: ENSORLT00000012557
Sequence length 587
Comment pep:novel chromosome:MEDAKA1:24:1847448:1850406:-1 gene:ENSORLG00000010006 transcript:ENSORLT00000012557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVKVVQLTSSSHHENLLASLHDLKLQEHLCDVTVQVEGMGDVQEFRAHQVVLAAISGYF
RKVLLTPGATEEKLLLSNMHCHDFSKFLDFAYTGKVEVVRKKIGDVQAMAQFLDCEGLSN
ICSEALSAGVLQKPRRKRCAATAEAVDELQEADKPEGEEELSPGETEGSKKLLKKRNRQK
NIKRPAKKLKLKLDGLKVMQKSWYFSLKEDNENQDEDAGEQENRTEEEDQRGTEEHDMSL
EKAASDGDDWECEEDEKASKAQFQCNKCQRTFHYERSYLKHISTYHGVQADIVHRCDICM
QTFANRSNLKIHEKHVHSNERQFACDSCSKTFKRKKDVIRHQRQVHERNLQHVCPDCGKT
LSSKAALLLHERTHTGSRPYECADCGARFTQNSALKMHRRTHTGEKPYACDECDARFTQK
HMLSYHKRSHTGEKPFMCEACGKSFASKEYLKHHSNIHTGFKPYKCVHCGRGFAQRNSLN
QHLKIHTGERPYCCKDCDKKFTQLNALQRHQRIHTGEKPYMCGLCKRTFTDKSTFRRHTL
VHDTDSPWKTYLVQLEGNLEERKPRSFKGEKAEKVEPGEKKSTPRKS
Download sequence
Identical sequences H2M2B5
ENSORLP00000012556 8090.ENSORLP00000012556 ENSORLP00000012556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]