SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012662 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012662
Domain Number 1 Region: 367-531
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-64
Family SPRY domain 0.0000103
Further Details:      
 
Domain Number 2 Region: 9-78
Classification Level Classification E-value
Superfamily RING/U-box 7.51e-20
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number 3 Region: 145-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.9e-16
Family B-box zinc-binding domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012662   Gene: ENSORLG00000010098   Transcript: ENSORLT00000012663
Sequence length 546
Comment pep:novel chromosome:MEDAKA1:18:22643679:22648689:1 gene:ENSORLG00000010098 transcript:ENSORLT00000012663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATGNLSEEQVHCSICLDVFTNPVSIPCGHNFCQNCILGYWKTSPLYQCPMCKKSFYKR
PDISVNTVLREIAEQFKQIRVKSMEEKASTKPAEGKAKKWTMEVLCDVCLGEGRPKAVKS
CLVCLSSYCEEHLNSHAARFTKHKLMEPVANMEDRMCPKHERLLELFCKKDQTCVCVLCT
ETDHRAHYTVPVEREWTEKKAQLKRTGIDVQQMIQDRVTKVEEIKLSLELNKASAKKEMD
ESMQVFSELVRSIQRAQAELVVAIEEKQRQTERRAQGLISELEQEISELKRRNADLENVA
RTDHIHFLQSFPALCTPPSVKDWSETSVPTDTCVGMIRRTVCHLEATLTEMIDKLLENEQ
SPGFASTVDVTLDPDTANPWLQLSQDRRQVRHLGAWQDLPDHPDRFDTVVIVLGREGFTS
GRHYWEVQVGDKDDWYIGVARSSVNRKGRISVSTTQGYWALALKKGQGYRVSTAPALQLS
LESKPKRVGVYVDYEEGQVSFYDVKARTHIYTFEASFTERIRPFFYLYCCDKASETMVIS
PVEHTK
Download sequence
Identical sequences H2M2L7
8090.ENSORLP00000012662 ENSORLP00000012662 ENSORLP00000012662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]