SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012673 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012673
Domain Number 1 Region: 353-514
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.33e-44
Family SPRY domain 0.00014
Further Details:      
 
Domain Number 2 Region: 5-68
Classification Level Classification E-value
Superfamily RING/U-box 1.81e-18
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 135-198
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000198
Family B-box zinc-binding domain 0.00068
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000012673
Domain Number - Region: 185-250
Classification Level Classification E-value
Superfamily Chorismate mutase II 0.0256
Family monomeric chorismate mutase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012673   Gene: ENSORLG00000010106   Transcript: ENSORLT00000012674
Sequence length 522
Comment pep:novel chromosome:MEDAKA1:18:22650402:22653910:1 gene:ENSORLG00000010106 transcript:ENSORLT00000012674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAFASLPEDQFLCSICLDIFTDPVTTPCGHNFCRTCLSQHWDDNELCHCPRCNKRFPSRP
DFCTNTIISEISVQVKRRKLEVMEDEGKPWRVMCDICTQFKLKASKSCLVCLTSYCEAHL
EPHHRVPALRRHGLIEPVENLEERVCEKHNRVLELFCRQERVCICLLCSEAEHKDHQFVA
VAEEAAQQRENIESTKAKIEQMINERKEKIKEVTEISEMSKKQVQAKKDLEDIEQLFTAL
MENVQNVQSKLKSNIERKLSKSQEKMQAIVGKLQEEITELQRKDTQLQELSQNQDSLRML
QTISDQTDCSQIRVYSDLCVQTVRRAVSHIMDVFGAELSRLRQYKGEIFNLELVTFDPST
AGGNLVVSDFGKRLKHPKIIYSSSSDDTEKFHLPMILGTKGFSSGRHYWEVQVGMRNIWD
VGVAAETADRSGRAALKKENGFFAIGKRGFDYQVHGTPYKVLHLCPRPRNLGVYLDYEEG
RVSFYDVGEKQHIHSFLGVEFTGKLFPYFYLYSKTKKSESLV
Download sequence
Identical sequences H2M2M7
ENSORLP00000012673 ENSORLP00000012673 8090.ENSORLP00000012673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]