SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013141 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013141
Domain Number 1 Region: 217-297
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.54e-23
Family PHD domain 0.00041
Further Details:      
 
Domain Number 2 Region: 420-701
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 0.000000000017
Family Hect, E3 ligase catalytic domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000013141
Domain Number - Region: 147-206
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000317
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013141   Gene: ENSORLG00000010482   Transcript: ENSORLT00000013142
Sequence length 708
Comment pep:novel chromosome:MEDAKA1:22:1809070:1816863:1 gene:ENSORLG00000010482 transcript:ENSORLT00000013142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKEENSKSDVVKAQDEDFCCVLCRINDDDPALFGEKVTLEQQKLTVHYLCLLTSCGVYQR
GKENEGILGFLVDDIRQEVRRSSHLTCVSCKKKGACVGCNVRSCRQMVHFPCGRNLSFIS
QFTEPFPSYCKNHAPSQSLSVDPNISLPQSCSVCLDSLDPVLSYSVLKCPSCHASWFHRD
CVQRQAFSAGLFFFKCTLCNNKDRFQQEMLRMGIYIPERDASWELESDAYSDLLEVYKHC
DSPSCLCEHGRSHSSIRGWFEVVRCCLCGSRGTHRKCSGLTLKTTDWACGDCTQATDGKA
SLVTSPQVVQRRSLVSKRHRSPIHSPISCKRLCWKSGSPEELLQSLGPQLHPGVAQVEVD
GDQALSAGLDLVRRADFDATHLLSVNIVQDANTARQYFLKLLHQQIQDSVVFEGPCGSKN
LALDAQALRDDLYFDVGCLLALCLVYGGPRLGFFSPGLYQCLFNYPPNCPLTVGHMTPGS
HFTQQISEAKSLEELRGVLEESWEFLQLAGCSRPVSSLEDNQNLVEDLVSFTMITRMQLP
LQRFREGLQTLGVFKQVQLHPSVFYNKFCEAAVPLTAQTLGQLFSVHFSKQEAKLNREMV
VVTFWRHFLLECEVGRCSVSLQDVLRFSTGAEELPAAGLLPAPAVSFLHHPESSAPGPKE
EEKWSDEGLFPQSRPESRSLHLPITSTYKAFKSCMEQAISHHVHLLPA
Download sequence
Identical sequences H2M3Y0
ENSORLP00000013141 8090.ENSORLP00000013141 ENSORLP00000013141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]