SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013538 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013538
Domain Number 1 Region: 367-508
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-44
Family SPRY domain 0.00047
Further Details:      
 
Domain Number 2 Region: 8-63
Classification Level Classification E-value
Superfamily RING/U-box 1.86e-18
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 3 Region: 148-214
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.46e-17
Family B-box zinc-binding domain 0.0007
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000013538
Domain Number - Region: 215-288
Classification Level Classification E-value
Superfamily BAG domain 0.0785
Family BAG domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013538   Gene: ENSORLG00000010794   Transcript: ENSORLT00000013539
Sequence length 508
Comment pep:novel chromosome:MEDAKA1:18:26719409:26721724:-1 gene:ENSORLG00000010794 transcript:ENSORLT00000013539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKGVDLDEESFSCSICLDLLKDPVTIPCGHSYCMKCLQGLWDAEEKVHSCPQCRKTFT
PRPGFFEFKFHTHVFVLLSWELKEAAAQMESVRSQSQTFSDPEEGVVCDVCTGRKLKAIK
SCLSCLASYCEEHLQPHLKAAALKKHKLVEPSKNLQENICSRHDEVMKMFCRTDQKSICY
LCSVDEHRGHDTVSAAAERTEKQRELEESQQQIQQRIQDREKEVKLLQQEVEAINHSADQ
SVEDSEKIFTEMIRLLQKRSRDVEQQIRSQQQTEVRRVKGLQEELEQDMAELKRRDAELK
QLWLTEDHSHFLLNYPSLPPLSESAPSASIHVRPLTYDILREEWTNISLTVSHLDVLLSE
PEPKSRADFLRYSCQITLDPNTANRYVLLSEENRKVARMEKPQTVSDHPDRFIKYSQVLS
RESLTGRCYWEVERRGKYVSVAVAYKNISRSGSKSLFGLNDKSWSLVCSPDRFSFVHNSI
ETSIPAPVPSRVGVYLDHRAGVLSFYSV
Download sequence
Identical sequences H2M516
ENSORLP00000013538 8090.ENSORLP00000013538 ENSORLP00000013538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]