SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013805 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013805
Domain Number 1 Region: 567-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.53e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 609-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000147
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 3 Region: 671-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000061
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 4 Region: 514-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000043
Family Classic zinc finger, C2H2 0.056
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000013805
Domain Number - Region: 439-516
Classification Level Classification E-value
Superfamily SET domain 0.00107
Family Histone lysine methyltransferases 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013805   Gene: ENSORLG00000011007   Transcript: ENSORLT00000013806
Sequence length 781
Comment pep:novel chromosome:MEDAKA1:23:5948853:5958960:-1 gene:ENSORLG00000011007 transcript:ENSORLT00000013806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDMNLSPVGMDQLSVASVSTGHLGLPTSPTHNAIPTPGMPVAIPSLGPSLGSLPSALSL
MLPMGPLSDRGVMCGLPDRNYSLPPPPYPHLESSYFRHILPGILSYLADRPPPQYIHPSS
LNMDGTLSVSSSNPSGLDPYSGPGGPLEQGLVPMDSRQVPGQADLHQTGPHELDSTGLTM
ESRVSSPISPDRMGEELASMDGVGVVAVSDSQQQLGGGRQPQPHEGLTGLDSSAGVMPLH
GSAVLELGEQLQSNGEMNNGVVSVVLTSSMAGQSQLEAVSLHGHSGMGLEAVNVSPITAE
VSLGPDNNLVLVNSTLQLEDSTPNKENVAPAYNVWCTLCERSYTSDCPEHGPVTFIPDTP
IQSRARLSLPRSLCLRISVADEPLGTKPPLLGVFARDIIHPRTCFGPLVGQHCTNADLSD
WPEKDTPQIWKMYHNNVLEFCIVTTDENECNWMIFVRRARTHEEQNLVAYPANGKLFFCT
TTEIHPEQELLFYYSRDYCRVMGVPQTPEGQICQCGKECSSFSELKAHLSSHNSNSTHNA
APHGHSPAKGPGHVREKKFKCSMCSRAFITSTKLNMHFMGHVGMKPHKCEYCSKAFSDPS
NLRMHLKIHTGQKNYRCTVCEKLFTQKSHVASHMLIHTGAEKLKCDLCDRAFIRKQDLKQ
HMFSHTHERQIQCPKCNKNFLKTNHLKKHMNSHEGRRDFVCEKCHKAFLTKYHLTRHLKI
CKGPKAEKTPREGKDPVEEEPEKDCRAARKAAERLMDAASDEDCGLDVGGYSSEKSLSPP
H
Download sequence
Identical sequences H2M5S2
ENSORLP00000013805 ENSORLP00000013805 8090.ENSORLP00000013805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]