SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013844 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013844
Domain Number 1 Region: 653-710
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 46-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.98e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 709-766
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 765-822
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 570-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.04e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 158-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 102-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 434-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 10 Region: 4-56
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 11 Region: 214-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 12 Region: 811-848
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000108
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 13 Region: 616-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000428
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 14 Region: 532-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000122
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013844   Gene: ENSORLG00000011040   Transcript: ENSORLT00000013845
Sequence length 849
Comment pep:novel chromosome:MEDAKA1:4:18748683:18769919:1 gene:ENSORLG00000011040 transcript:ENSORLT00000013845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIHTGEKPFSCEECGRSFTDKSSLTKHKRVHTGEKPFSCEECGKSFTEKSSLTKHKRVH
TGEKPFSCEECGKSFTEKSSLTKHKRVHTGEKPFSCEECGKSFTEKSNLTKHKRVHTGEK
PFSCEKCGKSFPLRQTLDVHIRIHTGEKPFLCAECGKSFTEKSNLTQHKRVHTGEKPFSC
EKCGKSFPLRQTLDVHIRIHTGEKPFLCEECGKSFTEKSNLTKHKRVHTGEKPYSCEKCG
KCFAHRQSFEVHMRIHTGEKPFFCTESRKACSVQKHISPINPIEHAFRLLKTKLQTERIH
CGNVQKQNEKECVSVQMFMVLTAYNEVIERPQKKPPPPPPQKKKPKKKTPLWETDPNGSL
RGKGCRSLPYPKDNEHNEADFHSQQLLTWSFDATTDGETNPLKRDGRSKSTVRNVDSCHR
SDQSDTESEKINAKSLRHHMKIHTGEKPFSCEECGRSFTVKSTLTKHKRVHTGEKPFSCV
ECGRSFTDKSSLTKHKRVHTGEKPLSCEECGKSFTEKSSLTKHKRVHTGEKPFSCEECGK
SFTDKSSLTKHKRVHTGDKPFSCVECGRNFTDKSSLTKHKRVHTGEKPFSCEECGKSFME
KSKLTKHKRVHTGEKPFSCEECGKSFMEKSKLTKHKRVHTGEKPFSCEECGKSFMEKSKL
TKHKRVHTGEKPFSCEECGKSFTQKSNLTKHKRVHTGEKPFSCEECGKSFMEKSKLTKHK
RVHTGEKPFSCEECGKSFTQKSNLTKHKRVHTGEKPFSCEKCGKSFPLRQTLDVHIRIHT
GEKPFLCAECGKSFTEKSNLTQHKRVHTGEKPFSCEECGKSFTRRQSFEVHMRIHTGEKP
FFFKECGSS
Download sequence
Identical sequences H2M5V8
ENSORLP00000013844 ENSORLP00000013844 8090.ENSORLP00000013844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]