SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014277 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014277
Domain Number 1 Region: 127-174
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000116
Family Hairy Orange domain 0.0037
Further Details:      
 
Domain Number 2 Region: 48-120
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014277   Gene: ENSORLG00000011401   Transcript: ENSORLT00000014278
Sequence length 420
Comment pep:known chromosome:MEDAKA1:6:16765039:16766860:1 gene:ENSORLG00000011401 transcript:ENSORLT00000014278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDERIAHLQDRQFVEHADFLGVDYPPLYMCKSKRGIKREDGGQQDAYKLPHRLIEKKRRD
RINECIGQLKDLLPEHLKLSTLGHLEKAVVLELTLKHLNALTAVTEQQHQKIVALQNGDR
SLNSPIHADLDVFHSGFQACAKEVLQYLSQFENWTAREQRCVQLVNHLHKVLAQFQPGAQ
ALQHQLPAGDAHDAQKTDGHANCVPVIQRTQGGELNENDTDTDSGYGGETEKSDGKEKEC
EGNNVQGLKAVKIKQEFGDERAAKKPKMSWTGKGVTSADQARPDLTFMNSLMGISSVGQQ
TPICMPFYFINPSAAASYMPFFDKNNIEKYVYPAAAALASPFPWLYPAHAAAAAAAAFPG
LSAHFGASSQPKDARSLDNDGSYEADAASPEERVESPASEDAEGDADSSPEGKNCANDAS
Download sequence
Identical sequences H2M726
ENSORLP00000014277 8090.ENSORLP00000014277 ENSORLP00000014277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]