SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015126 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015126
Domain Number 1 Region: 361-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-50
Family SPRY domain 0.00035
Further Details:      
 
Domain Number 2 Region: 147-211
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.65e-16
Family B-box zinc-binding domain 0.00058
Further Details:      
 
Domain Number 3 Region: 14-67
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000424
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000015126
Domain Number - Region: 186-314
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0115
Family FCH domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015126   Gene: ENSORLG00000012084   Transcript: ENSORLT00000015127
Sequence length 534
Comment pep:novel chromosome:MEDAKA1:14:22410384:22414464:-1 gene:ENSORLG00000012084 transcript:ENSORLT00000015127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTAISLLISESDEQDACFLCKEDLRDPVSIPCGHIFCSICLKTYWDHADHTGSYLCPQCK
VNYNKRPTPRRIGGSRYGTLNRNSEPFPPPPPSPDYNYAGPQDVGCDICIGKKHKAIKTC
LMCLASYCEKHLKPHFESATFKRHKLVDEIGHLDRQICPQHQKGLELFCRTDQMCICVLC
TVKEHKGHDMVSAEQERAEEQQRLGATQAEIQEKIHDRLKQMEELKQAVDSLKNSAQRAL
QECEKMFGDMMRSIERMQQEMAKLISTNKRAALSNAEGHMERLNHEIADLKRRDSEITQL
SRTEDHIHFIQTYHMLIAQTEAEELPSVTVNPYFSFGPVTKAVSEMKQHMNEFSNDELVK
VAKTDACQLTLDPNTAYRQLYLSRGNRKATLKRDTQSYSDHPNRFDSLPQVLCKEPLAGN
AFYWEVDWSGEGAAIGIAYKGIKRTGYGDHARIGHNRKSWSFFCSDSSYSARHSKDQVEI
NAPYCPRIGIFLDHVGGTLSFYAVGDTMSLLHTFKASFSEPVYPGFWVWCTNQG
Download sequence
Identical sequences H2M9E3
ENSORLP00000015126 8090.ENSORLP00000015126 ENSORLP00000015126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]