SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015130 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015130
Domain Number 1 Region: 442-737
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.37e-51
Family Eukaryotic proteases 0.00084
Further Details:      
 
Domain Number 2 Region: 119-234
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-31
Family Spermadhesin, CUB domain 0.00084
Further Details:      
 
Domain Number 3 Region: 312-373
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000113
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 232-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000524
Family EGF-type module 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015130   Gene: ENSORLG00000012089   Transcript: ENSORLT00000015131
Sequence length 737
Comment pep:novel chromosome:MEDAKA1:6:18124098:18141307:-1 gene:ENSORLG00000012089 transcript:ENSORLT00000015131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCKGCFTDMGVISFLKLTPLCSLDYRYHCPGPEWSVMCRGCCEYNVIRCKCPLQGTQVGY
AVPCCRNAINECDPCIIHPGCSIFENCRRCNNGTWGPRDDFFINGQYCAECRPGWSGGDC
MKCGGVIRKRQGHLVLESYPNNARCEWTIQVDRPFTVELRFMMLSLEFHPSCRYDYVEVR
DGDSINSRIIGRFCGNNKPAAVHSTGNSLHVLFVSDGYKNFDGFFATFQESSACSSSPCL
HDGTCILDSSYTYHCACLAGYTGKRCESVLSEGENTVESFELEMMKNSTQESRNKEKENN
TIGSPIPGKSSCPPLPRLSNGYHQVVPELEPKTVEFRCNHSYALSGSVRRSCQKNGTWSG
QQPMCVRACREPKVSELVRQRVLAPQVPSRKTPVHKLLTASLGQRLQSEGPTKAPEVLPQ
LPQGFHNLYTHIEYECVSQYYQHSGSSRRTCLKTGKWSGRHVSCSPVCGKHAAFDPERPE
EAHWPWLAAIYRCPTKNTETKASDWQLVCSAALVNQRSLVVAAHCVTELGKVYPVDAATV
SVVVGKHYRDDHRKQKGLQWLRVASIAVHPNYDPNILDSDIAVIKLIDKARIGEKVLPLC
LSGSEEEEMNSGQGLVTGWSPMSDSSLGPEEKARVGLVHLADIVPCEQQYARNGVPVSVT
DNMLCASQRPDYNPSNICPSDTGGILVLPEVGRDSKRLWRLLGLVSFGYDQGECDPDLYT
VYTRVANFKDWIESNMK
Download sequence
Identical sequences H2M9E7
8090.ENSORLP00000015130 ENSORLP00000015130 ENSORLP00000015130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]