SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015566 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015566
Domain Number 1 Region: 216-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.37e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 160-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 69-119
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000262
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 258-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000664
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 105-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000172
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015566   Gene: ENSORLG00000012434   Transcript: ENSORLT00000015567
Sequence length 321
Comment pep:novel chromosome:MEDAKA1:23:10608942:10610057:1 gene:ENSORLG00000012434 transcript:ENSORLT00000015567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPWIKEQQEEISVSQEEEQLGLKQEDDIVMVTLHEENELIEDFNNQQFQTQSFNGNSCDK
TSKKKKSKFACKDCGKKYSSISTLTNHRRIHNGEMPYCCEECGKSFHLRSTFRSHVLAHK
PAKLFVCDKCGKSFSENCHLTGHMRIHTEATLFCEECGKSFRHGCNLKRHMLTHTGQKPF
SCEECDKSFSQSTTLRNHMTIHTGAKPFSCKECDKSFNRRSTLDNHIKTHAGARPFLCKV
CGKSFTLKITLTSHTRIHTGEKPFACEECGKSFTHRTSLKKHMNTHLEEMFCDVCSVSFS
RRKDFTEHMRRHASAEDVLQM
Download sequence
Identical sequences H2MAL1
ENSORLP00000015566 8090.ENSORLP00000015566 ENSORLP00000015566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]