SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015593 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015593
Domain Number 1 Region: 237-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000142
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 2 Region: 186-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000351
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015593   Gene: ENSORLG00000012453   Transcript: ENSORLT00000015594
Sequence length 432
Comment pep:novel chromosome:MEDAKA1:23:10632974:10647453:-1 gene:ENSORLG00000012453 transcript:ENSORLT00000015594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGALRPELHSTPNGPGSSSGTCAAVPVSEPSDGEGRPRVSSARCPGEDKGGQNPPGCQ
PTEPANGEEPGAQPPEPRGGSRARAGLCYRVEGARVPEGEQRAPRRCIESAEGHERGSES
QTGTELGSLDRESPCRVDSEDSISSTLMDMESTASSGRSTPAMLSSHDGGVTAAASAVAG
GKSLSYTCFWDECQLLFSSSPDLAEHIRASHVDRQRGGVFVCLWKGCKVYNTPSTSQSWL
QRHMLSHSGDKPFKCVVGGCSATFASQGGLARHVPTHFSSQGSSKASSQGRTKEESPSKA
GHKKRKLRNKYRRSLPRPHDFFDAQTMDAIRHRAICLNLATHIESLGNGNSVVFHSRVIA
RRKEASGKVKLLLHWTPEDILPDVWVNENDQLQMKTKVVHLSKLPADTAVLLDPTLYRFR
RLSLFPLITNPP
Download sequence
Identical sequences H2MAN6
ENSORLP00000015593 8090.ENSORLP00000015593 ENSORLP00000015593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]