SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015594 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015594
Domain Number 1 Region: 715-821
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-17
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000015594
Domain Number - Region: 30-70,105-278
Classification Level Classification E-value
Superfamily ARM repeat 0.0334
Family Clathrin adaptor core protein 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015594   Gene: ENSORLG00000012452   Transcript: ENSORLT00000015595
Sequence length 835
Comment pep:novel chromosome:MEDAKA1:13:23977779:24042630:1 gene:ENSORLG00000012452 transcript:ENSORLT00000015595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKMHQLFSQVLNQRDLSRAGDLFSLEDSDIEDCLSQALDQIKNISCSPDYLTNDNDQAVV
EICITRITTAIRETGSVERHSTALVGLWESCLEHNLTPQGENTEDTPHAKIASDITSCIL
QNYSSPSVMVLAVPVAVRFLQRGNRELSRNMSSYLSLAAIAKADLLAEHTEAIAVSVLEG
NYMLLRVLPSVYPKRPETIHRYLGDLTAVMPQLEPPEQQHLIRLIQVVAEQHPISQMLSM
HVPALVNYLSLPCLSEALLGALVEVSQACPSSLVSFLPALRTLGQRSSAYLANVAKIHGA
VGIISESHAHSSLLYLVCLLGSMEHSFHHTLLLEIRALTDRYPSLLGGCGKDIYRMSNSF
TAIAKQLGRRLEDRTAADCRKKLHRLINDPKLSLMFSNELLLLLENDTEQRLQVEIQNEE
DNLAELEKEVLADSPAPQRHYSLSQAVKEERREMRFNRSKSLALHEVCSRSINSDAGEDG
EGVEFSTETSNPLPCRPSENQEVSPTGRKQTGDGAPPAAAAAQSHKEAEKCQNGEVDAEQ
VETDKLFLHLRDNMETIREFCKDMVQQVPTPDQCVIEGETDSSGGCVAKLSFSCPLKGHY
CLYAKSSFHLTSRQPHLWIHIMLLHLQSKSSVPLCTRDESIQQLAALWEKTQLKGSHSFL
MAMTQHSTPHRKELENLQIQLEEVRFFDLFGYREDQRSWLCFMCNNPEKATVVNQEGQPL
IEGKLKEKQVRWKFIKRWKTHYFTLAGNQLLFRRGKSKDELEDFPIELSKVQSVKVVTKK
RRDRGLPRAFEIFTDSKTYVLKAQDEKHTEEWLQCINVAVAQAKERENREATTYL
Download sequence
Identical sequences H2MAN7
ENSORLP00000015594 8090.ENSORLP00000015594 ENSORLP00000015594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]