SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015614 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015614
Domain Number 1 Region: 221-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.68e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 344-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 490-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 450-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000773
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 6 Region: 390-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000094
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 535-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000204
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 124-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000164
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 9 Region: 86-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000875
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000015614
Domain Number - Region: 307-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0258
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015614   Gene: ENSORLG00000012472   Transcript: ENSORLT00000015615
Sequence length 600
Comment pep:novel chromosome:MEDAKA1:6:19139778:19141580:-1 gene:ENSORLG00000012472 transcript:ENSORLT00000015615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSSWASPGAKPNPYGRTRMTETWQQHTVAPPVVHNIPTATENALGCAVYGIVLQPDAAS
LQQQQGQHEQQQHPAQNSLQVGAEEAHKCETCGHDISHLVDPLEHQCVVTQDRSFQCTQC
LKIFHQATDLLEHQCVQVEQKPFVCGVCKMGFSLLTSLAAHHTSHNSSNPMKCSICEKTY
RPGSSGNTTPTSSNNSQHTSSDAASASSSSSILPFPSARDRPYKCSVCQKGFKHLSELTR
HERVHTGEKPFKCDTCDKAFSQSSHLQHHQRTHSNERPFKCAVCEKSFKHRSHLVRHMYV
HSGEHLFKCNLCELHFKESSELLHHPCHPQGTRPFRCAACGKGFKRPSDLRQHERTHSEE
RPFHCDECQMSFKQQYALARHRRMHKDPTDRPFKCNLCDKGFMQPSHLLYHQHVHGMDNL
FKCASCQKEFSQSGELLRHKCGESSSASLDKPYKCDVCGKGYKKSSTLQRHQNSHCQEKP
LKCSLCERRFVSSSEFVEHRCDPSREKPLKCPDCEKRFKYTSDVNRHRRVHTGEKPFQCD
HCDKAFKQREHLTKHKSTHSREGQFKCVWCGERFSDLGSLQDHTVQHTAEGGNYSMSQCI
Download sequence
Identical sequences H2MAQ5
ENSORLP00000015614 8090.ENSORLP00000015614 ENSORLP00000015614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]