SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015690 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015690
Domain Number 1 Region: 644-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-16
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 2 Region: 702-756
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000562
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 292-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000889
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 741-793
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000286
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 5 Region: 478-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000451
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 401-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000642
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 571-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000362
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000015690
Domain Number - Region: 352-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0044
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number - Region: 773-827
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00471
Family Classic zinc finger, C2H2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015690   Gene: ENSORLG00000012533   Transcript: ENSORLT00000015691
Sequence length 1090
Comment pep:novel chromosome:MEDAKA1:14:23377076:23391234:-1 gene:ENSORLG00000012533 transcript:ENSORLT00000015691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQTPDEFIWCEDCGQYHDSECPELGPLVTVEDSFVLSRARSSLPNSLEIREVANGEEG
VFVLRRLVKRTRFGPFEAKRVSSVEKEGAFPLKVFLKEGMVLCFDCSSEEDCNWMMLVRP
ATDHRHQNLTAYQQDDDVYFNTSQDVLPGTELRVWYGAFYAKKMEKPMLKPPLPSLMSPP
GKTPNRVITGSRHDNIKIEPSEIIESNMAPVIENKNLGKFIVVFASSVVYKFSLVYPLQT
VNQSATAHARPPAEGSAPRPREAAAADGRSLLSSAADGAVVPKRHKTREHKRVYRCSLCS
KIFQNSSNLNRHIRSHGDKLFKCDECDKLFSRKESLKQHISYKHSKNVPDKEYRYKCNTC
EKSFRLENALKFHNCRTGAQTSPQVAMEPALMCLTLSLDDKTFQCDICSRFFSTNSNLSK
HKKKHGEKLYSCEICNKMFYRKDVMQEHHRRHSVGPKHMKREELDTNGEEGTKYRKEPSP
CPICGKVFSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDEQER
EDFIKKIGISADDSDETDEDEDEDDPEHHKYNCKKCQLSFAKGKEYLKHIMEQHKEKGYG
CAICNRHFALKATYNAHLVIHREQLPDPAVQKYIHPCEICGRIFNSIGNLERHKIIHTGV
KSHGCEQCGKSFARKDMLKEHLRVHDDNRDYLCAECGKGMKTKHALRHHMKLHKGIKEYE
CKECNRKFAQKVNMLKHYKRHTGIKDFMCELCGKTFSERTTLETHKLIHTVGKTWKCETC
DKKYLTEYMLQKHVHLTHEKVEAQSCHLCGTKVSTRASMNRHLRRKHPDSAASLRSDDFD
DLQENSAVSNSSVSHVQSTLSLEKDGMSLDRPARPSRQPKRKQRAVAEPELSDTDDYGDF
SEARQEPVAEFNTVIVGDETETDSAVQSIQQVVVVLADPNTPSAPSPNSSVGLTNITVTP
ITSHAPAQFTSLQPVAVGHLTASDRPLTLDNSILTVTFDAVSGSAVLHNRPAELVHEAVG
SAGGAPQSVAHFINLTTLVNPMSHQMEAPTLAWRPVPPAEGSQVTQVVEGAQGESQECQS
QGGEQQMFSY
Download sequence
Identical sequences H2MAX7
ENSORLP00000015690 8090.ENSORLP00000015690 ENSORLP00000015690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]