SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016233 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016233
Domain Number 1 Region: 8-75
Classification Level Classification E-value
Superfamily RING/U-box 8.48e-19
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 2 Region: 353-418
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000038
Family SPRY domain 0.0046
Further Details:      
 
Domain Number 3 Region: 136-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000229
Family B-box zinc-binding domain 0.00081
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000016233
Domain Number - Region: 94-359
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 0.0119
Family RNA-polymerase beta-prime 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016233   Gene: ENSORLG00000012954   Transcript: ENSORLT00000016234
Sequence length 419
Comment pep:novel chromosome:MEDAKA1:21:13166342:13168628:1 gene:ENSORLG00000012954 transcript:ENSORLT00000016234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKDLDEESFCCSICLDLLKDPVTIPCGHIYSMKCLQGLWDEENVHSCPRCRKTFTARP
VLVKSTMLAVLVEQLKKTGLQAAPASLCSAGSEDVVCDVCTGRKLKAIKSCLSCPASYCE
KHLQPLKAAAFRKQKLVEPSKNLQENICSRHDEVMFCRTDQKCICYLCSVDEHRGNDTVS
AAAERTEKQREMEESQQQIQQRIQDREEVKLLQQEVEAINHSADQTVEDSGKIFTKMILL
IQKRSCDVKQQIRAQQQTEVRRVKGLQEELEQEITELKRRDAELKQLPLTEDHSHFLLNY
PSLPPLSESTPSAIINVRPLTYFEDVTTAVSELRDKLQDILRELNLITISFKRLLEVEAG
ITLDPNTACRHLLLSDENRKVTYMEKPQSEHPDRFTIHAQVLSRESLTGHCYWEVETRG
Download sequence
Identical sequences H2MCE8
ENSORLP00000016233 8090.ENSORLP00000016233 ENSORLP00000016233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]