SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016364 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016364
Domain Number 1 Region: 455-590
Classification Level Classification E-value
Superfamily TIMP-like 7.85e-27
Family Netrin-like domain (NTR/C345C module) 0.02
Further Details:      
 
Domain Number 2 Region: 230-326
Classification Level Classification E-value
Superfamily Immunoglobulin 3.93e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 408-462
Classification Level Classification E-value
Superfamily BPTI-like 3.83e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0025
Further Details:      
 
Domain Number 4 Region: 344-403
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000199
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.021
Further Details:      
 
Domain Number 5 Region: 146-198
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000638
Family Ovomucoid domain III-like 0.031
Further Details:      
 
Domain Number 6 Region: 59-104
Classification Level Classification E-value
Superfamily Elafin-like 0.000000497
Family Elafin-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016364   Gene: ENSORLG00000013057   Transcript: ENSORLT00000016365
Sequence length 598
Comment pep:novel chromosome:MEDAKA1:1:32466454:32468767:1 gene:ENSORLG00000013057 transcript:ENSORLT00000016365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCEIPLQLQDQRNSGSTTGWGYAHSPRNLWGWTRACLLVLLVGDFLEFSSCSSEAGAQAA
HEGFCPNKLNSNLWVDAQSTCERECGTDEDCADFEKCCTNVCGLNSCVAARFSDGTPAQP
DGKDGGTAAPNSSATCEGFICSQQGATCDIWDGQPICKCQDRCEKEPNFTCASDGLTYFN
RCYMDAEACIRGVTLTVIPCRFYLPGPHTSPLPQGTTAYPTPTSSLEDPMPPTLYTNPHH
QSIYVGGTVSFHCDVVGVPRPDVTWEKQSERRERLVMRPDQMYGNVVITNIGQLVIYNAQ
VWDTGIYTCIARNSVGALRADYPLSVIRRAEDDFSEDPEMPMGRPFSPADCLAEVDLRVC
SAERHVDWYYDSKLGSCVTFSNGGCDDSRNRFETYEECKASCQREGMGICSLPAVQGPCK
AWEARWAWNSMLKECQPFAFGGCQGNANNFHTKKECEANCPQPKRRPCRTCRMKGKIISS
LCRSDFAIVGRLTELVEDLNSGLARFSLDEVLKDEKMGLTFFNTKNLEVTITTMDWSCPC
PNITVEENPLLVMGLVHDGMAIIQTDSYVKAITERRLRRLRAALHKKPCEPVQSLGKT
Download sequence
Identical sequences H2MCS7
8090.ENSORLP00000016364 ENSORLP00000016364 ENSORLP00000016364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]