SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016441 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016441
Domain Number 1 Region: 1086-1282
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.16e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 866-989
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-28
Family Pleckstrin-homology domain (PH domain) 0.0000124
Further Details:      
 
Domain Number 3 Region: 34-56,87-155
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000263
Family PDZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016441   Gene: ENSORLG00000013115   Transcript: ENSORLT00000016442
Sequence length 1783
Comment pep:novel chromosome:MEDAKA1:20:22016662:22054003:1 gene:ENSORLG00000013115 transcript:ENSORLT00000016442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNSPAEAQAKPKDGREQSEPSATASPGAEEEPFSWPGPKTLCLRRTSQGFGFTLRHFIVY
PPESAVHNSLKDDENGSRGLCGHPKGRHENEEDIFIKETQNNGPERQRHFCFCAGDRIVK
VNGESIIGKTYSQVIALIQNSDASLELCVMPKDEDILQLFLEMDCKXKGNEAYSGNAQNI
PEPPPICYPRIELKTAGSAQTSEPLPGPGRRGGAAEKSYRMEIPVSPSPLQAAARTAPPD
PVERGSQLARAGPSHRAEENRYGVSANRTAVPSGQGGTQLQHPAQTPVFPPAKPAAAHPD
TLPPPARDATSAAISPSPNHCSPSPPAPPSSPHQHIDWRNYTTYKDYIDAKRLHSYGCRT
IQERLDSLRAAADSAYSQQRTPPPSNSQRGAPGSQVRRRSASNERGGDISCTGAAPLRSV
SQDRLGGGTERAAADRNWPRSASQDALPFSPAVRVLKPRARSCDYLSQPPVERGGADPGD
RAAVEERLLQCRAGLGSGQKALPHLRRNLAVQEEETQRGGSSSPPAAAADPTEGTTDSAP
TSRTEGLILRPSRLPVKTSEAAPASSPAKTADPLKDQRAGAMGNHQDSCPPLHLQLRSRA
DSLKVENRSESGLAARSSSCSGASSKPLRQPHIGVVTVSSRIPPPKTNHGSAEGVEGPDS
TVVVLRKDRNFGPARPRPPSYAFAVNDNKEEVAYRPPPLVKAGSADGAMCWMSAESCRDL
HLRGLGENRQQSGSTNLDNSLDSIPFIDEPSSPSIDLDSTHIPASVVICGTPTITTIPPS
PTSSSPLIRRQLSHDQDSFRLTIVESDSGSKTERSKSYDEGLDNYQDGRGRSLIPGLKGL
RKAIDRSSEDSGSRGDSSSDVFCDATKEGFLHFKQLHTDKGKRVGGGMRPWKQVYAVLRG
HCLCLYKDRREGQAHASCQTVEEPLQISIKACLIDISYSDTKRKNVLRLTTSDCEYLFQA
EDREDMLAWIRVIQENSHLDEESAVFSSHDLISRKIKEYNTLMSPTGSKSEPSPRTSRQS
LSIRHTLLGGKGEAKAPSPQSPKAEVEKRSVLKDDTSPPKDKGTWRKGIPGLMRKPFEKK
SSAGFTFGVRLDDCPPAQTNKFVPLIVEVCCKLVEERGLEYTGIYRVPGNNSAISNMQEE
LNNKGVSDIDVQEDKWKDLNVISSLLKSFFRKLPEPLFTNRRYADFIEANRIEDPVERLK
VLKRLLHELPDHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTTEDNMTHM
VTHMPDQYKIVETLIQNYDWFFTEDGNGDPVTLSRQESAVESQPVPNIDHLLTNIGRTGA
SQGEVSADSPASDSAKSKGSWGSGREPCSRELLVSSIFAAASRKRKKSKEKVQPSSSDDD
LDPVFSAMELPAQKPDPRGLQAETQTHPGPDGRQEAAALERKENGGVPELASKAKREHRI
SLYLKETPPKQHSPNAIRRNARQGKSSLSDPPSQLEENPSDLGTMSSGASVPRSRPKKWA
AGGSPDLLVNMEVKRRPVHPPPRAESGQEGGPEARRLFPSQKMIESDTLSRRWSFRQKTD
SDSSAEGTVGGEGRPESSTRLSRVLEVMKKGRSSSSISSSSRSESERPEPPWHLKITERL
KFRLRSSADDMLAPRSRAAEARGKKRSIRRRHTMGGQRDFAELAVIHDWREQGGGDGAAD
LSALDRLKPRCSSQDFSIRDWIARERCKGSEPSAAVAPKAVPEDDPAEAQGHAPQGRSPG
APAGEQLNGSGPQSKNKPSLGTDPHPHKLSGAQVVRSRFYQYL
Download sequence
Identical sequences H2MD02
ENSORLP00000016441 8090.ENSORLP00000016441 ENSORLP00000016441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]