SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016653 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016653
Domain Number 1 Region: 690-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.73e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 468-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-19
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 731-783
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 310-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000121
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 510-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000942
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 431-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000146
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 282-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000148
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 8 Region: 348-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000261
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 9 Region: 15-44
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000096
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 10 Region: 642-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000969
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000016653
Domain Number - Region: 119-141,208-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000152
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number - Region: 61-90
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0155
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 543-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0747
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016653   Gene: ENSORLG00000013290   Transcript: ENSORLT00000016654
Sequence length 840
Comment pep:novel chromosome:MEDAKA1:16:18075702:18081256:-1 gene:ENSORLG00000013290 transcript:ENSORLT00000016654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPEQMEAEETYVEHQYMCSECQELFDTLEDVLIHQQIHTGQEVDGDVVEGISLAQMGQ
NQQFQCLECGGLLLNAEELLQHQEMHMQEAGMEVEQQVCEVLETEHTNTEAQMSGPVQYQ
CLDCLALFDAPESWLEHRRTHSRSSTPSQPQPNIVGTTKTEYLLQPDGSVTPLNNVQNYV
LSEQQAVSPTYCSGSRPATTTEVCFQVVVIHPYECSECSLLFQTPEDFLLHQGEHFLGQD
KESGESGVMGALEEIRGRQETSDKMEGMRNRVGGKRGGAWAKPLQCELCSRIFTSVNRLA
AHKRVHEQGTHECPECGKVFKKATSLQTHMRTHSGVARYLCVDCGTGFTTEMTLIMHRKS
HVADPLHKCQFCSKTFTNMTKYLYHRRTHLNREASDTPSSMFSPQRDPGVPPSPAASAEA
PSTPLSDKGAFSCRLCPKTFPSQLQLTHHRRKAHATERSFVCGICGQAFKKQINVRNHIR
THTGEKPFQCSECGKTFSLLANLMRHTLIHSGVRPYRCDVCHRSFSVSSNLRQHSLLHSN
AATLTCPDCPATFRTPVKLAAHRFTKHPGAPAPFPCPHCEAGFLNRKQRDNHCLEQHLAV
VQGGAQMEETQEAQGPPQPSTSAAAGMKPEVSTSLVKGGLDCNICGKKLNSPANLRLHRL
SHFTPGLGRPRCIPGKRPKAHQCPICGKLFVSSSGVALHQRVHTGERPFPCQVCGKRFRQ
NTHLREHLRTHSGERPFRCEVCGKAFIQSMHLAEHRRTHTGERPHVCPLCGKAFKTFSNL
RNHKMTHDRQQRVQGTPTIMCDEFGETIAIIETTEGGALPLEQALEIYHTALENGLAVET
Download sequence
Identical sequences H2MDK8
ENSORLP00000016653 ENSORLP00000016653 8090.ENSORLP00000016653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]