SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016723 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016723
Domain Number 1 Region: 341-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.55e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 104-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-17
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 3 Region: 382-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000116
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 145-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000377
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 204-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000244
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 6 Region: 266-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000016
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000016723
Domain Number - Region: 61-106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00282
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016723   Gene: ENSORLG00000013344   Transcript: ENSORLT00000016724
Sequence length 560
Comment pep:known chromosome:MEDAKA1:16:18115300:18125245:1 gene:ENSORLG00000013344 transcript:ENSORLT00000016724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGESFLNTTLFLYHRKQHRQKGEEKVVVVPEVVPEEVYTQSNGTTEHEAAGLASSPSPTF
TQPEVFFCIKCGESCNDEEGLVKHRKDWARTPLPHVCPYCGKKFTRRVFLRTHVYSHTGE
KLFTCKVCTKSFTNSQSLLRHSMSHTGNKPFCCDVCGKNFSQSATLKRHQQIHSSLQPRR
TCPNCPSRFSTEEQLNHHKLLHTSHPFPCPDCGEAFKRRKDLDLHSLTHQDKQPATCPHC
ASQFINQSVLEIHLQRCPTTEEERNIECDLCGHRCMTQEGLDLHRLSHTGQTPLKCPVRP
CRRRFTSNSALEEHVLAHFQGTLSKSKNRPRFRCEICHKEFAYKSTFNVHMRTHTDERPF
ECTTCGKRFRQLPHLQDHMRIHSGARPFCCWICGKSFSVAARLTEHARTHSGEKPYPCPH
CAAAFRSRPNLDKHLRLHGELPLYTSEDAVQAAEAAQVQKVLEGAKTLSSLSATAEVESA
TVQTIYVLQGAEGTTETVMIPSDQLGGIEGASQVVILPSSVLGAQGITVPTITMEDSEIT
MVETSQSPQHTIEFIVEETV
Download sequence
Identical sequences H2MDS2
ENSORLP00000016723 8090.ENSORLP00000016723 ENSORLP00000016723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]