SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017287 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017287
Domain Number 1 Region: 361-518
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-31
Family SPRY domain 0.00037
Further Details:      
 
Domain Number 2 Region: 10-77
Classification Level Classification E-value
Superfamily RING/U-box 2.65e-18
Family RING finger domain, C3HC4 0.0064
Further Details:      
 
Domain Number 3 Region: 133-198
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000229
Family B-box zinc-binding domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017287   Gene: ENSORLG00000013784   Transcript: ENSORLT00000017288
Sequence length 518
Comment pep:novel chromosome:MEDAKA1:23:13971600:13973198:-1 gene:ENSORLG00000013784 transcript:ENSORLT00000017288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTINLISEEQLLCSICHDVFKEPVSTRCGHNYCKSCITEYWDSSCQIQCPLCRTKFHT
RPKFLVNTEFRAMVEHFSHIQVKSEGEIAQAGDVPCDVCTETKIKAHKTCLVCLASYCQT
HLEPHQSLKKHKLVDPLSNLCDRVCKKHDKMLELFCCTDQECVCLMCWRDGHANHHVILC
EKAFREKKALLTNAISEMKTTENKNAGSVNKLKTSFQQRKKASEKDMADIGMFLTGLVTE
VQEGKGKVIELIKQKQKRVDTIGNVYFAKMDQEAAEMRRKRCELEQLLQTEDHLHFLLSY
QRYNQTAAIQSNSIEPLDNNQPVYGEMVKKSTSQMKKTLSNHIEGLLHQLLSEDELMMIQ
QCNAVDLTFNAFGGHISLMVSRDGKQLSLRKDRFVLSTLFGERFENLPIAFSTNSFSSGR
FYYEVRVNKNQNFILGVAKESINMKPISYPTTVDGVWTFRLLFGNVYEVFDPNEIRLFLK
QAPEVIGVFVDYEKGEVSFYDVEARYLMYSYKGCCFTE
Download sequence
Identical sequences H2MFB5
ENSORLP00000017287 8090.ENSORLP00000017287 ENSORLP00000017287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]