SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017511 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017511
Domain Number 1 Region: 355-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-49
Family SPRY domain 0.00076
Further Details:      
 
Domain Number 2 Region: 138-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000656
Family B-box zinc-binding domain 0.0007
Further Details:      
 
Domain Number 3 Region: 11-68
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000182
Family RING finger domain, C3HC4 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017511   Gene: ENSORLG00000013971   Transcript: ENSORLT00000017512
Sequence length 519
Comment pep:novel chromosome:MEDAKA1:1:34174673:34177196:-1 gene:ENSORLG00000013971 transcript:ENSORLT00000017512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAWCSCMSSSDNSLCPLCADGIRDPVTIPCGDTYCLDCIKIYWDQFDHMGVYSCPQCRAT
FTPRPVLRRNLPDVQHQPRQQLPQLTPFPYMHRESYCDFCVGRRNKAVKSCLMCLAYYCE
THVKPHYESSTFKRHKLVDEMGHLDRKICPQHEKGLELFCRTDQMCICVLCTVREHRSHN
IASAEDERIEKQKVLVVTQTEVQHIISERMKELQELKHNVDVLKNAAQRAQTESDKTFHE
MLQAVERWKAEISQMILANMQAAMSQADGYVERLEQEIMELQRRDAELRQILETEDNIHF
LQNFPTLCVAPEAMVPKVLINPQFSFGEISKTATEMKENLDDICKKELSKISKTDFLRYA
CKLSFDPNTVYKELVLSDGNQRVTRKKSVQFYPDHPERFDGFSQVLCREPMSGFRFYWEA
EWSGEFSIGVAYKGINRKGKNSSLLGYNDKSWSLLCSDSGYSAWHNTADKDLPNAPRTTR
IGVYLDHAGDTLAFYAVSDSMQLIHKFKAHFSEPLYAGF
Download sequence
Identical sequences H2MFY4
8090.ENSORLP00000017511 ENSORLP00000017511 ENSORLP00000017511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]